KEGG   Burkholderia glumae BGR1: bglu_1g01740Help
Entry
bglu_1g01740      CDS       T00905                                 

Definition
(GenBank) BadF/BadG/BcrA/BcrD ATPase family protein
  KO
K18676  
glucosamine kinase [EC:2.7.1.8]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_1g01740
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.8  glucosamine kinase
     bglu_1g01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:182521..183423
Genome map
AA seq 300 aa AA seqDB search
MQQTRAGTAPIHLLGIDGGGTGTRAVLADAHGRELARGSGGPSGLALGIDAAWASIGAAC
AEAFAQAGLRIDWARCVLGCGLAGSNHPEWLAGFAASSPAAALAVESDAYTTALGAHGGA
PGVIVALGTGSIAAALDAQGRCRIAGGYGFPSGDEASGAWFGLRALAHAQQALDGRVPAD
GFAAALLEKTGATDRDSLVVWSCAANQTAYAMLAPVVFAHREHPVAAGLIAEAGGAIGRM
IDALDPARTLPVALCGGLAGHLEAAVPEPHRARLRAPLADSAHGALRLAQREAARLAGAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagacgcgcgccggcacggcacccattcatctgctcggcatcgacggcggcggc
accggcacccgtgccgtgctcgccgatgcccacggacgcgagctggcgcgcggcagcggc
ggcccctcggggctcgcgctcggcatcgacgcggcctgggcgtcgatcggcgcggcctgc
gccgaggcgttcgcgcaggccggcctgcggatcgactgggcgcgctgcgtcctgggctgc
gggctggccggcagcaatcatccggagtggctggcggggtttgccgccagctcgcccgcc
gccgcgctggcagtcgagagcgacgcctacaccactgcgctcggtgcccatggcggcgcg
cccggcgtgatcgtcgcgctcggtaccggcagcatcgcggccgcgctcgacgcgcagggc
cgctgccggatcgccggcggctacggctttccctccggcgacgaggcaagcggcgcctgg
ttcgggttgcgcgcgctcgcccacgcgcagcaggcgctcgacggccgcgtgccggccgat
gggttcgcggcggcgctgctcgaaaagaccggcgccaccgatcgcgacagcctggtggtt
tggtcgtgcgcggcgaatcagaccgcctacgcgatgctcgccccggtcgtgttcgcgcat
cgcgagcatccggtcgcggccgggctgatcgccgaggcgggcggcgcgatcggccgcatg
atcgacgcgctcgatcccgcgcggacgctgccggtggcgctgtgcggcgggctggccggc
cacctcgaggctgccgtgcccgagccgcaccgcgcgcggctgcgcgcgccgctggccgat
tcggcgcacggcgcgctgcggctcgcgcaacgcgaggccgcgcggctggccggcgcccgt
tga

DBGET integrated database retrieval system