KEGG   Burkholderia glumae BGR1: bglu_1g01820Help
Entry
bglu_1g01820      CDS       T00905                                 

Definition
(GenBank) chemotaxis two-component response regulator CheY1
  KO
K03413  
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bgl  Burkholderia glumae BGR1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bglu_1g01820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    bglu_1g01820
Two-component system [BR:bgl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   bglu_1g01820
Bacterial motility proteins [BR:bgl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    bglu_1g01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:189897..190271
Genome map
AA seq 124 aa AA seqDB search
MIRSILAIDDSATMRGLLQVTLADAGYDVTVAADGDRALELAAAIAFDLVLTDHHMAGKN
GLDVIRALRARGTYRQTPILVLTTESSDTFKAAARDAGATGWIEKPLEPDTLLSLVAALA
PSHP
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctccattctggccatcgacgattccgcgaccatgcgcgggctgttgcaggtg
acgctcgccgacgccggttacgacgtgaccgtggcggccgacggcgaccgcgcactggaa
ctcgctgccgcgatcgccttcgacctggtgctgaccgaccatcacatggcgggcaagaac
gggctcgacgtgatccgcgcgctgcgcgcgcgcggcacctatcggcagacgccgatcctg
gtgctgaccacggagagcagtgacacattcaaggcggccgcgcgtgacgcgggcgccacg
ggctggatcgagaaaccgctcgagccggacacgctactcagtctcgtcgccgcgctggcg
ccgagccatccgtag

DBGET integrated database retrieval system