KEGG   Burkholderia glumae BGR1: bglu_1g01830Help
Entry
bglu_1g01830      CDS       T00905                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  
two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bglu_1g01830
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    bglu_1g01830
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     bglu_1g01830
Protein kinases [BR:bgl01001]
 Histidine protein kinases
  CheA family [OT]
   bglu_1g01830
Two-component system [BR:bgl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   bglu_1g01830
Bacterial motility proteins [BR:bgl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    bglu_1g01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:190338..192602
Genome map
AA seq 754 aa AA seqDB search
MTLDITQFYQTFFDEADELLAQMEQLLLGLDAGSPDPEDLAAIFRAAHSIKGGAATFGFA
ALTDTTHILESLLDRARNHEITLTVPMIDAFLETKDVLSAQLADYRASAEPDAAAAAAIC
AKLESLLKEALGGGAAGPAAPQPVAAAPAAPAAAPEPDSDADLESAFAAASAEFDSATGG
APEHVVTQAVEATHPGSGGGEAEGGAQDGAHLKVVLSGVDAKDRELLVEELGNLGHIVER
SESGGALTLWLESDVPSDDIVAVLCFVIDESQISIGRGTAPSAGGPAEIVTAAAPQEVRD
TPAPAAEAQPAAPSAPATPPAAAPAAPAAAHADHGDAAKPAASAEDRRARAPAAAGAEGS
SIRVGVEKVDQLINLVGELVITQAMLAETANAFDPALHDRLFNGMAQLERNARDLQEAVM
SIRMMPMDYVFSRFPRLVRDLAAKLGKEVELVTFGQATELDKSLIERIIDPLTHLVRNSL
DHGIETVERRRAAGKDAVGQLVLSAAHHGGNIVIEVSDDGAGLNRERILKKAAQQGIPVS
ETASDDEVWNLIFAPGFSTAETITDVSGRGVGMDVVKRNIQAMGGHVEISSTAGRGTTTR
IVLPLTLAILDGMSVKVGNEIFILPLNFVMESLQPAAADIYTVGNGERVVRVRGEYLPLV
ALHEVFSVDDARTDPTQGIVTIMETEGRRFAMLIDELVGQQQVVVKNLETNYRKVHGISA
ATILGDGSVALIVDVAALNREARTAHGAGALATF
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgacatcacacagttctatcagaccttcttcgacgaggccgacgagctgctc
gcgcagatggagcagctgctgctcggcctggacgccggctcgccggacccggaagacctc
gcggccatctttcgcgccgcgcattcgatcaagggcggggcggccaccttcggtttcgcc
gccctgaccgacacgacccacatcctggagtcgctgctcgatcgggcccgcaatcacgag
atcacgttgaccgtgccgatgatcgacgcgttcctcgagaccaaggacgtgctctccgcg
cagctggccgactaccgcgcgagcgccgagccggatgccgccgcggccgcggcgatctgc
gccaagctcgagtcgctgctgaaggaggcgctcggcggcggtgccgccgggcccgccgcg
ccgcagccggtggcggccgcgccggccgcgccggccgccgcgccggagcctgactcggac
gccgatctcgaaagcgcgttcgcggcggcctcggccgaattcgattcggccaccggcggc
gcgcccgagcatgtcgtgacgcaggccgtggaggccacccatccgggcagcgggggcggt
gaggccgagggtggcgcgcaggacggtgcgcacctgaaggtcgtgctgagcggcgtggac
gcgaaggatcgcgagctgctggtcgaggagctcggcaatctgggccacatcgtcgagcgc
agcgaatcgggcggcgccctgacgctctggctcgaaagtgacgtgccgtccgacgacatc
gtcgccgtgctctgcttcgtgatcgacgagagccagatctcgatcggccgcggcaccgcg
cccagcgcgggcggcccggccgagatcgtcacggcggccgcgccgcaagaggtgcgcgat
acgccggcgccggccgccgaggcccagccggccgcacccagcgcaccggcgacgccgccg
gctgccgcgccggcggccccggccgccgcgcacgccgatcacggcgacgcggccaagccg
gccgccagcgcggaagaccggcgcgcgcgcgcgccggccgccgccggcgccgagggcagc
tcgatccgcgtcggcgtggagaaggtcgaccagctgatcaacctggtcggcgaactcgtg
atcacgcaggcgatgctggccgagaccgccaacgcgttcgatccggcgctgcacgaccgc
ctcttcaacggcatggcgcagctcgagcgcaatgcgcgcgacctgcaggaagcggtgatg
tcgatccgcatgatgccgatggactacgtgttcagccgcttcccgcgcctggtgcgcgac
ctggccgcgaagctcggcaaggaagtggaactggtcacgttcggccaggcgaccgaactc
gacaagagcctgatcgaacgcatcatcgatccgctcacccacctcgtgcgcaacagcctc
gaccacggcatcgaaacggtcgagcggcgccgcgcggcgggcaaggacgcggtcggccag
ctggtgctgtcggccgcgcaccacggcggcaacatcgtgatcgaggtcagcgacgacggg
gccgggctgaaccgcgagcggatcctgaagaaggccgcgcagcagggcatcccggtgtcc
gagacggccagcgacgacgaggtctggaacctgatcttcgcgccgggcttctcgactgcc
gagaccatcaccgacgtgtccggccgcggggtgggcatggacgtggtcaagcgcaacatc
caggcgatgggcggccacgtcgagatctcgtcgacggccgggcgcggcaccaccacccgc
atcgtgctgccgctcacgctggcgatcctcgacggcatgtccgtcaaggtcggcaacgag
atcttcatcctgccgctgaacttcgtgatggagtcgctgcagccggctgccgccgacatc
tacacggtcggcaacggcgagcgcgtggtgcgcgtgcgcggcgaatacctgccgctggtg
gccctgcacgaagtgttctcggtggacgatgcgcgcaccgatccgacccagggcatcgtc
accatcatggaaaccgaggggcgccgcttcgcgatgctcatcgacgagttggtgggccag
cagcaggtggtggtgaagaacctcgagaccaactaccgcaaggtacacggcatatcggcc
gcgaccattctcggcgacggcagcgtggcgctgatcgtcgacgtggccgctctcaaccgc
gaagcccgcaccgcccacggcgcgggcgcgctcgcgactttctaa

DBGET integrated database retrieval system