KEGG   Burkholderia glumae BGR1: bglu_1g02000Help
Entry
bglu_1g02000      CDS       T00905                                 

Definition
(GenBank) hypothetical protein
  KO
K08972  
putative membrane protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:210782..211135
Genome map
AA seq 117 aa AA seqDB search
MSLILTWIINALALLIITYLVPSIHIRSFGTALIVAVVLGLINAVIRPVLILLTLPVTIL
TLGLFILVVNALCFWLASSLLKGFEVSGFWSAFFGSILYSIVSWLLSALIFGQRSIG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcctgacctggatcatcaatgccctcgcgctgctcatcatcacctacctg
gtgccgtcgatccacatccgcagcttcgggacggcgctgatcgtcgcggtcgtgctcggg
ctgatcaacgcggtgatccggccggtgctgatcctgctgacgctgcccgtgacgatcctc
acgcttggcctgttcatcctcgtcgtcaacgcgctctgcttctggctggcgtcgtcgctg
ctgaagggcttcgaggtgtccggcttctggtcggcgttcttcggctcgatcctgtacagc
atcgtgtcgtggctcctgtccgccctgatcttcggccagcgcagcatcggctga

DBGET integrated database retrieval system