KEGG   Burkholderia glumae BGR1: bglu_1g02010Help
Entry
bglu_1g02010      CDS       T00905                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  
methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bgl  Burkholderia glumae BGR1
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    bglu_1g02010
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     bglu_1g02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:211155..211985
Genome map
AA seq 276 aa AA seqDB search
MKPIELSLEFFPPKTAEGVDKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLLAAPHLSCIGASKDNLRAVLDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRLEVAAYPEYHPQSRSPKLDLLHFAEKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARRLESFGDDKESIRAFGADV
VTAMCERLIREGAPGLHFYTLNAATATKVVCERLGF
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatcgaactctccctggaattctttccgccgaagacggcggagggcgtcgac
aagctgcgcgccacgcgcgcgcagctcctgccgctgaagccgaagttcgtctccgtgacg
ttcggcgccggcggctcgacgcagcaaggcacgctcgacacggtgctcgacatgcagaag
gacggcctgctggccgcgccgcacctgtcgtgcatcggcgcctcgaaggacaacctgcgc
gcggtgctcgaccagtaccgttcgcacggcatccgccacatcgtcgcgctgcgcggcgat
ctgccgtcgggcatgggcgaggtgggcgagctgcgctacgcgtcggaactcgtcagcttc
atccgcgccgagcacggcgactggttccggctcgaagtggccgcgtacccggaataccat
ccgcagtcgcgttcgccgaagctcgacctgctgcacttcgccgagaaggtgaaggccggc
gcgaattcggcgatcacgcagtacttcttcaacgcggacgcctacttccgcttcgtcgac
gacgcgcgcaagctcggcgtggacgtgccgatcgtgccgggcatcatgccgatcaccaac
ttcacgcagctgatgcgcttctccgagatgtgcggcgccgaagtgccgcgctgggtcgcg
cgccggctcgagagcttcggcgacgacaaggagtcgatccgcgcgttcggcgccgacgtg
gtcaccgcgatgtgcgagcggctgatccgggaaggcgcgccggggctgcacttctacacg
ctgaacgcggcgacggcgaccaaggtggtctgcgagcggctcggtttctga

DBGET integrated database retrieval system