KEGG   Burkholderia glumae BGR1: bglu_1g02020Help
Entry
bglu_1g02020      CDS       T00905                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K01426  
amidase [EC:3.5.1.4]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Arginine and proline metabolism
Phenylalanine metabolism
Tryptophan metabolism
Aminobenzoate degradation
Styrene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    bglu_1g02020
   00360 Phenylalanine metabolism
    bglu_1g02020
   00380 Tryptophan metabolism
    bglu_1g02020
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    bglu_1g02020
   00643 Styrene degradation
    bglu_1g02020
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     bglu_1g02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(212133..213587)
Genome map
AA seq 484 aa AA seqDB search
MQDDYPNYDATDLAALIATRRASAREVLDAAIARANALNPSINAIVLTDYDAARERAAAP
PAGPLGGVPYLVKDLAAAAGLRMSLGSRHYRYFVPDADAPFIARAKAAGANVFGKTSTAE
FGQMPVTEPELFGPCRNPWNLDHTPGGSSGGAAAAVAAGIVPLAHASDGGGSIRIPASCC
GLFGFKPGYDPQLAAQPVPGDLIVNHAISRSVRDSALLFDLTTGRAGTSEATLARLDEPV
GALRIGLVTDPLFAAALSPDVLAALDDAARLAESLGHVVEPMRLPIDQARAAETFLTCWA
AIVEPLVHDAQALTGRRPRGDEFEPASRAMAQVGRHLARERLPLARDWQKQLIAQVESAT
ARYDLVLCATLAAPPVRIGELRSTPFERAQMRLLAALPARPLLRMMLANTAKRAFAWAGC
TELFNLTGQPAMSVPLHWNARGLPVGVQFAARRGDDARLLRFARQLELARPWFARRPPLV
PAAR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggacgattacccgaactacgatgccactgacctcgccgcgctgatcgccacccgg
cgggccagcgcgcgcgaggtgctcgacgccgcgatcgcgcgcgccaacgcactgaatccg
tcgatcaacgcgatcgtgctgaccgactacgacgcggcccgcgagcgggccgccgcgccg
ccggccggcccgctcggcggcgtgccctatctcgtcaaggatctcgcggcggcagccggg
ctgaggatgtcgctcggcagccgccactaccgctacttcgtgcccgacgccgacgcgccg
ttcatcgcgcgtgcgaaggcggccggcgccaatgtgttcggcaagaccagcaccgccgaa
ttcggccagatgccggtgaccgagcccgagctgttcgggccgtgccgcaacccctggaat
ctcgatcacacgccgggcggctcgagcggcggcgcggcggcggccgtggcggccggcatc
gtgccgctcgcgcatgcgtccgacggcggcggctcgatccgcatccccgcctcgtgctgc
ggcctgttcggcttcaagcccggctacgatccgcaactggcggcgcagcccgtgccgggc
gacctgatcgtcaaccatgcgatctcgcgcagcgtgcgcgacagcgcgctgctgttcgac
ctcaccacggggcgcgccggcacctccgaggccacgctcgcgcggctcgacgaaccggtg
ggggcgctgcgcatcggcctcgtcaccgatccgctgttcgcggcggcgctgtcgcccgac
gtgctggcggcgctcgacgacgcggctaggctagccgaatcgctcggccacgtggtggag
ccgatgaggctgccgatcgaccaggcgcgcgcggccgagaccttcctcacctgctgggcc
gccatcgtcgagccgctggtccacgacgcgcaggcgctcacggggcgccggccgcgcggc
gacgagttcgagccggcgagccgcgcgatggcgcaggtcgggcggcatctcgcgcgcgag
cgtctgccgctcgcgcgcgactggcaaaaacagctgatcgcgcaggtggagagcgccacc
gcacgctacgacctggtgctgtgcgcgacgctggcggcaccgcccgtgcggatcggcgag
ctgcgctccacgccgttcgagcgcgcgcaaatgcgcctgctcgccgccctgccggcgcgg
ccgctgctgcgcatgatgctcgcgaacacggccaagcgcgcgttcgcctgggccggctgc
accgagctgttcaacctcaccggccagccggcgatgtcggtgccgctgcactggaacgca
cgcggcctgccggtcggcgtgcagttcgccgcgcgccgcggcgacgacgcgcggctgctg
cgattcgcgcgccagctcgaactcgcgcggccgtggttcgcgcggcgtccgccgctggtg
ccggcggcgcgctaa

DBGET integrated database retrieval system