KEGG   Burkholderia glumae BGR1: bglu_1g02030Help
Entry
bglu_1g02030      CDS       T00905                                 

Definition
(GenBank) Putative dienelactone hydrolase
  KO
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    bglu_1g02030
   00361 Chlorocyclohexane and chlorobenzene degradation
    bglu_1g02030
   00623 Toluene degradation
    bglu_1g02030
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     bglu_1g02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(213697..214392)
Genome map
AA seq 231 aa AA seqDB search
MTSQWIDIPVGNETFGGYLALPKGGKGPAVVIIQEIFGVNGHIRSVAEQYAADGYVALAP
DIFWRTQPRVELGYEGADFNKGLELLQKTDPHQAAADIGHAVAALRARPEVEGKRVAGIG
YCFGGRLAYLAAAAGALDVAVAYYGGGIQNHLDVANHVTQPIQFHYAGLDDHIPAEAVEQ
VRAAFGGRAHAQVHWYPDAGHGFNCNVRASYNQRAAALAHGRTLTFLAEQL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgcaatggatcgacatcccggtcggcaatgaaacgttcggtggctaccttgcc
ctgcccaagggcggcaagggaccggccgtggtgatcattcaggaaatcttcggcgtgaac
ggccacatccgttcggtcgccgagcaatatgcggccgacggctacgtcgcgctcgccccg
gacatcttctggcgcacccagccgcgcgtggagctcggttacgaaggcgccgacttcaac
aagggcctggagctgctgcagaagaccgatccgcaccaggccgcggccgacatcggccac
gcggtcgccgcgctgcgcgcgcgccccgaggtggaaggcaagcgtgtggccgggatcggc
tactgcttcggcggccggctcgcctacctggccgcggcggccggcgcgctcgacgtggcg
gtcgcctactatggcggcggcatccagaaccatctcgacgtcgcgaaccacgtcacgcag
ccgatccagttccactacgccggcctcgacgaccacatcccggccgaggcggtcgagcag
gtcagggccgcgttcggcggccgcgcgcacgcgcaggtgcactggtatccggatgccggc
cacggcttcaactgcaacgtgcgcgcctcctacaaccagcgcgcggcggcgctcgcgcac
ggccgcacgctgaccttcctcgccgagcagctgtaa

DBGET integrated database retrieval system