KEGG   Burkholderia glumae BGR1: bglu_1g02050Help
Entry
bglu_1g02050      CDS       T00905                                 

Definition
(GenBank) Amino acid ABC transporter, permease protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(216364..217569)
Genome map
AA seq 401 aa AA seqDB search
MSDPSSRLPPQPAAHRALSPAARHRARAATMALFFVAGMMYASWGVHVPTVRDRFALSPA
LLSLALLAVAIGSIIAMTTNAKWIARVGTRTACLAGGIGMSVCGALILLAPSYPLLIVVL
MLFGFTMATLDVAMNAEASAVEIAFGKPIISMLHGMFSIGGLSGAALGGALLSAGMAPPM
HLALASLVCAAIIAAACPAVLPHVPHQAAEHDSSLNRWRSAALWALGAIALVSLIAEGAM
YDWATVYMRDVVAATPAFASAAYAAFSGGMAGGRFAGDVVRARFGAPQLVFASATFACIG
MIGALLLPYPAPALIGFTMMGLGLSNMMPLLFAAAARVAGISPAEGLAHVAGLAYFGLMF
GPVVIGGVAQAAGLPVGLAIVALCAAIVAAFAPRVMRRLNV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatccgtcctcccgccttcccccgcagcccgccgcccaccgcgccctgtccccg
gcggcacgccaccgcgcccgcgcagccaccatggcgctgttcttcgtcgccggcatgatg
tacgcctcgtggggcgtgcacgtgccgaccgtgcgcgaccgcttcgcgctgagtcccgcg
ctgctgtcgctcgcgctgctcgccgtggcgatcggctcgatcatcgcgatgaccaccaac
gcgaaatggatcgcgcgggtgggcacgcgcaccgcctgcctggccggcggcatcggcatg
tcggtgtgcggcgcgctgatcctgctcgcgccgagctatccgctgctgatcgtcgtgctg
atgctgttcggcttcacgatggccacgctcgacgtcgccatgaacgccgaggcgagcgcg
gtggagatcgcgttcggcaagccgatcatctcgatgctgcacggcatgttcagcatcggc
gggctgagcggcgcggcgctcggcggcgcgctgctgtcggcgggcatggcgccgcccatg
cacctggcgctcgcctcgctggtgtgcgcggcgatcatcgcggcggcctgcccggcggtg
ctgccgcacgtgccgcatcaggcggcggagcacgactcgtcgctcaaccgctggcgctcg
gccgcgctctgggcgctcggcgcgatcgccctcgtctcgctgatcgccgagggcgcgatg
tacgactgggccaccgtctacatgcgcgacgtggtggccgccacgccggcgttcgcgagc
gccgcctatgccgcgttctcgggcggcatggcgggcggccgcttcgcgggcgacgtcgtg
cgcgcgcgcttcggcgcgccgcagctggtgttcgcgagcgcgacgttcgcctgcatcggg
atgatcggcgcgctgctgctgccgtatccggcgccggcgctgatcggcttcacgatgatg
ggcctgggcctgtccaacatgatgccgctgctgttcgccgcggccgcgcgcgtggccggg
atctcgcccgccgaagggctcgcgcacgtggccggcctcgcctatttcgggctgatgttc
ggcccggtcgtgatcggcggcgtcgcgcaggccgccgggctgccggtcgggctggcgatc
gtcgcgctgtgcgcggcgatcgtcgccgcgttcgcgccgcgggtcatgcgccggctgaac
gtctga

DBGET integrated database retrieval system