KEGG   Burkholderia glumae BGR1: bglu_1g02060Help
Entry
bglu_1g02060      CDS       T00905                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase family protein
  KO
K07226  
heme iron utilization protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:217764..218438
Genome map
AA seq 224 aa AA seqDB search
MKLSVSLPIHLLHRGQTGTLATHAREPAGFPYPTIVPYATDARHRPVVLVSALAEHTRNL
AADPRAGFLVADPEPAVVPAASAVLEAERVTLVGRFVRSDDDPHLAARYQRYHRDAARYL
GLGDFAFWVLECERLRFIGGFGRMGWLDGAELDALPPLSFDQEQALWARYPADERARELI
GVDRHGADWRIDGRLRRTAFANPATDFHALIDAVEIAATTIDSP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgtccgtctcgctaccgatccacctgctgcatcgcgggcagaccggcacgctt
gcgacccatgcgcgcgagccggccggcttcccgtatccgaccatcgtgccctacgccacc
gatgcgcggcatcggccggtggtgctggtcagcgcgctggccgagcacacccgcaatctg
gccgccgacccgcgcgccggctttctggtggccgacccggaaccggccgtcgtgcccgcc
gcgagcgcggtgctcgaggccgaacgtgtcacgctcgtcggccgtttcgtgcgaagcgac
gacgatccgcatctcgccgcgcgttatcagcgatatcaccgcgatgcggcgcgctatctc
gggctcggtgatttcgcgttctgggtgctcgaatgcgagcggctgcgcttcatcggcggc
ttcggtcgaatgggctggctcgacggcgccgaactggacgcactgccgccgctctcgttc
gaccaggagcaggcattatgggcgcggtacccggctgatgagcgcgcgcgggaattgatc
ggcgtcgaccggcatggcgccgattggcggattgacggacggctgcgacgtaccgctttt
gccaatccggcgaccgatttccacgcactcatcgacgccgtcgagatcgcggcgaccact
attgattcgccgtga

DBGET integrated database retrieval system