KEGG   Burkholderia glumae BGR1: bglu_1g02120Help
Entry
bglu_1g02120      CDS       T00905                                 

Definition
(GenBank) Lipoprotein A family protein
  KO
K03642  
rare lipoprotein A
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:223129..223758
Genome map
AA seq 209 aa AA seqDB search
MKFRLPRQLGSVMMVAALTGCAMPPNPASEQAANNDNPAKHALRTTAAARSDDAAGKQDD
FDAALATMPAAGTDDASHASLSNAKPIDAADISDFRQTGRASWYGRAFHGRRTANGDRFD
MNELTAAHRTLPLSSYVKVINQANGKSVVVKINDRGPFKRGRVLDLSYAAAKVIGLVRSG
TARVKIVGLSPEQARIARDETVASASPTH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcgattaccgaggcaactcggttcagtaatgatggtggcggcgctcaccggg
tgtgccatgccgccgaatccggcctccgaacaggcggccaacaacgacaacccggcgaag
cacgcacttcggaccacggcggcagcccggtcggacgacgcggccggcaagcaggacgat
ttcgacgcggcgctggcgacgatgccggccgccggcaccgacgacgcgtcgcacgcgtcg
ctgtcgaacgcgaagccgatcgacgcggccgacatatccgactttcggcagaccggccgc
gcctcgtggtacggccgcgcattccatggccggcgcaccgccaacggcgaccgcttcgac
atgaacgagctgaccgccgcgcaccgcacgctgccgctgtcctcgtacgtgaaggtcatc
aatcaggccaacggcaaatccgtcgtggtgaagatcaacgatcgcgggccgttcaagcgt
ggccgcgtgctcgatctgtcctatgcggccgcgaaggtgatcggcctcgtgcgctcgggc
accgcgcgcgtgaagatcgtcggcctctcgcccgagcaggcgcgaatcgcgcgcgacgaa
acggtcgcgtcggcctcgccgacacactga

DBGET integrated database retrieval system