KEGG   Burkholderia glumae BGR1: bglu_1g02150Help
Entry
bglu_1g02150      CDS       T00905                                 

Definition
(GenBank) phosphoheptose isomerase
  KO
K03271  D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00540  Lipopolysaccharide biosynthesis
bgl01100  Metabolic pathways
Module
bgl_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    bglu_1g02150
Enzymes [BR:bgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     bglu_1g02150
Lipopolysaccharide biosynthesis proteins [BR:bgl01005]
 Unusual sugar
  bglu_1g02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS_2 SIS Usp PHY
Motif
Other DBs
NCBI-ProteinID: ACR27416
UniProt: C5A8Y7
Position
1:225637..226221
Genome map
AA seq 194 aa AA seqDB search
MSVERIQQHIRDNATLVQEVLDALSLPIAAAVDAMFAALANGNKILACGDGPSAAPAERL
ANALTGGFERERPSLPGLALATDASRAGPFTGGEAADHIFAQQVRALGQTGDVLVVIDPS
GDSPRALAAAAEAREREITVIALTGSGGELVSALSDTDIHIGVPSERALRIQEIHLLTIH
CLCDGIDAMLLGED
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgaacgtattcagcaacatattcgcgacaacgcaacgctcgtccaggaagtg
ctcgatgcgctgtcgctgccgatcgcggccgccgtcgacgcgatgttcgccgcgctcgcg
aacggcaacaaaatcctcgcctgcggcgacggaccgtcggccgcgccggccgagcggctc
gcgaacgcgctgaccggcggcttcgagcgtgaacggccgagcctgccgggcctcgcgctc
gccaccgacgcgagccgtgccggcccgttcacgggcggcgaggcggccgatcacattttc
gcgcaacaggtgcgcgcgctcggccagaccggcgatgtgctggtcgtgatcgatccgtcc
ggcgattcgccgcgtgcgctggccgcggccgccgaggcgcgcgagcgcgagatcacggtg
atcgcgctgaccggcagcggcggcgagctggtgagcgcgctgtccgacaccgacattcat
atcggcgtgccgtccgagcgggcgctgcgcatccaggaaatccacctgctgaccatccac
tgcctgtgcgacggcatcgacgcgatgctgctgggcgaagactga

DBGET integrated database retrieval system