KEGG   Burkholderia glumae BGR1: bglu_1g02220Help
Entry
bglu_1g02220      CDS       T00905                                 

Definition
(GenBank) 2-hydroxy-3-oxopropionate reductase
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:232180..233049
Genome map
AA seq 289 aa AA seqDB search
MDIGFVGLGEMGSAIAANLLKAGHRVRVWNRSPEKAAPLVAQGAQPAATIGDAFAGDLVL
SMLADDAAVRGVFDAGLLEQASRGLIHVNMATISVALAETLAHAHAERGLHYVAAPVLGR
PNVAALGQLTIIAAGPAEAIDRVQPAFDVIGKKTWRLGSLPQHANAVKLAANFSIASAIE
TMGEAAAMLAGHGVAVSDYIDVITNSILPGPVYQGYGTMIAERRYEPAMFKARLGLKDVR
LALEAADAVSVPMPVGSVLRDNLIDAIAHGDGERDFAVLGEVAARRAGR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggatatcggatttgtcgggctcggcgaaatgggcagcgcgattgccgcgaacctgctg
aaggcgggccaccgcgtgcgggtctggaaccgctcgccggagaaggccgcgccgctcgtg
gcgcagggcgcgcagccggcggccacgatcggggacgccttcgccggcgacctggtgctg
tcgatgctggccgacgacgcggccgtgcgcggcgtgttcgacgcggggctgctcgagcag
gcgtcgcgcgggctgatccacgtgaacatggcgaccatttcggtcgcgctggccgaaacg
ctcgcgcacgcgcatgccgagcgcggcctgcactacgtggcggcgccagtgctcggacgc
ccgaacgtggccgcgctggggcagctgacgatcatcgcggccggcccggccgaggcgatc
gaccgcgtgcagccggccttcgacgtgatcggcaagaagacctggcggctcggctcgctg
ccgcagcacgcgaacgcggtgaagctcgcggcgaatttctcgatcgcctcggcgatcgag
acgatgggcgaggctgccgcgatgctggccgggcacggcgtggccgtcagcgactacatc
gacgtgatcaccaacagcatcctgccggggccggtctaccagggctacggcacgatgatc
gccgagcgccgctacgagccggccatgttcaaggcgcggctcgggctcaaggacgtgcgg
ctcgcgctcgaggcggccgacgcggtgtcggtgccgatgccggtcggcagcgtgctgcgc
gacaacctgatcgacgcgatcgcgcacggcgacggcgagcgtgatttcgcggtgctgggc
gaggtggccgcgcgccgcgcgggacgctga

DBGET integrated database retrieval system