KEGG   Burkholderia glumae BGR1: bglu_1g02240Help
Entry
bglu_1g02240      CDS       T00905                                 

Definition
(GenBank) OmpW family outer membrane protein
  KO
K07275  
outer membrane protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(233976..234812)
Genome map
AA seq 278 aa AA seqDB search
MNKTLLRGAAVLAAALGASGAQAQSAGSNVIGLGWFHITPIQSSTSLVTNVAPTPINTPL
SLPPSFDSPGTGLRTNNSDTLGLTISHFFTDNVAVTSVAGVPPVFQVSGHGTIVPPGPAG
ALGTQNIGLDAVNPIVKSVRQWSPAVILQYYFANANSKLRPFVGIGVSYNWFSDLQLSNN
FIKQTQDNLGSILAAGAGKPGTTQVSAKASSSWQPVFNAGLTYSINQHWGLIASVTYIPL
KTTSTVTIKAADGTTLAESKGDLKANPIISYLAVSYKF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagacccttcttcgcggcgcagccgtgctcgccgccgcgctcggcgccagcggc
gcgcaggcgcaaagcgccggcagcaacgttatcggcctcggctggttccatatcacgccg
atccagagcagcacgtcgctggtcaccaacgtggccccgacgccgatcaacacgccgctg
agcctgccgccctcgttcgactcgccgggcaccgggttgcgcaccaacaactcggacacg
ctcggcctgacgatcagccacttcttcaccgataacgtcgccgtcacctcggtggcgggc
gtgccgccggtgttccaggtatcggggcacggcacgatcgtgccgcccgggccggccggc
gcgctcggcacgcagaacatcgggctcgacgcggtcaacccgatcgtcaagagcgtgcgc
cagtggagcccggccgtgatcctgcagtactacttcgcgaacgccaattcgaagctgcgg
ccgttcgtcggcatcggcgtgtcgtacaactggttcagcgacctgcagctcagcaacaac
ttcatcaagcagacgcaggacaacctcggttcgatcctcgcggccggcgccggcaagccc
ggcaccacgcaggtgtcggcgaaggcgtcgtcgtcgtggcagccggtgttcaacgcgggt
ctgacctactcgatcaaccagcactgggggctgattgcctcggtaacctacatcccgctg
aagaccacctcgaccgtgacgatcaaggcggccgacggcacgacgctcgccgaatcgaag
ggcgacctgaaggcaaacccgatcatcagctacctcgcggtgtcgtacaaattctga

DBGET integrated database retrieval system