KEGG   Burkholderia glumae BGR1: bglu_1g02270Help
Entry
bglu_1g02270      CDS       T00905                                 

Definition
(GenBank) PEBP family protein
  KO
K06910  
uncharacterized protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(238199..238795)
Genome map
AA seq 198 aa AA seqDB search
MRESRQTKRTGRRRGVSAWRLLAVLAAAFASLARPGAQTPFSVTSPELRDGGRVSAAQRY
GRGACRGENRSPALAWQNPPRGTRSYAITMFDLDAPGRGWWHWAVADIPASASGVPANAS
GSGFLGRLGAVEARNDFGSDGYGGPCPPPGKPHRYVITVYALDIERLRADQGRPPQLFDH
EISVSALASARLTVTDER
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagcaggcagacgaagcgaaccggccgcaggcgcggcgtgagcgcgtggcgc
ctgctcgccgtgctggccgcggcgttcgccagcctggcgcggcccggcgcgcagacgccg
ttctcggtgacgagtcccgagctgcgcgacggcggccgcgtgagcgccgcgcagcgctac
gggcgcggcgcctgccgcggcgagaaccgctcgccggcgctggcctggcaaaacccgccg
cgcggtacgcgctcctatgcgatcacgatgttcgacctcgacgcgccgggccgcggctgg
tggcactgggccgtggccgacattccggcctcggcctccggcgtgcccgcgaacgcgagc
ggctccggcttcctcggtaggctcggcgcggtcgaggcgcgcaacgacttcggcagcgac
ggctacggcggcccgtgcccgccgcccggcaagccccaccgctacgtgatcaccgtctac
gcgctcgacatcgagcgcctgcgcgcggaccagggccggccgccgcagttgttcgaccat
gagatcagcgtctccgcgctcgcctccgcacgtctgaccgtcaccgacgaacgctag

DBGET integrated database retrieval system