KEGG   Burkholderia glumae: bglu_1g03290Help
Entry
bglu_1g03290      CDS       T00905                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bgl  Burkholderia glumae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bgl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bgl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:348425..349771
Genome map
AA seq 448 aa AA seqDB search
MQVSVNERDAVSHVATANPSAGRVSQGQPERLVITGGRRLSGEIRVSGAKNAALPILCAG
LLSAEPLRLDNVPDLQDVRTMLALLGGMGVKSAVDGARVTLDAASVTDPVAPYELVKTMR
ASILVLGPLLARFGYAKVSLPGGCAIGARPVDQHIKGLQAMGAEITIEHGYIEARATRLK
GARLVTDMITVTGTENLLMAATLADGETVIENAAREPEVTDLANLLVAMGARIDGIGTDR
LVIQGVERLHGASHAVVPDRIEAGTFLCAAAAAGGELTLRGMRANLLDAVLGKLRETGAK
LDERDDALRVTMDRRPAAVAIRTSEYPAFPTDMQAQFMTLNAVAAGTAHVVETIFENRFM
HVQELNRLGADIVVDGNTALVTGVTQLSGARVMATDLRASASLVIAGLCADGETVIDRIY
HLDRGYDRMETKLNAVGADVRRITGSAA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtttcagtcaacgaacgcgacgcggtaagccacgtcgcgacggcgaacccgtcc
gccggccgggtttcgcaaggacagccggagcggctcgtgatcaccggcggcaggcggctt
tccggcgagatccgggtgtcgggcgcgaagaacgcggcgctgccgattctctgcgcgggc
ctgctcagcgccgagccgctgcggctcgacaacgtgcccgacctgcaggacgtgcgcacc
atgctcgcgctgctgggcgggatgggcgtgaagagcgcggtggacggcgcgcgcgtcacg
ctcgacgcggccagcgtgaccgatccggtggcgccttacgagctggtcaagaccatgcgc
gcgtcgattctcgtgcttggcccgctgctggcgcgcttcggctacgcgaaggtatcgctg
ccgggcggctgcgcgatcggcgcgcggccggtggatcagcacatcaaggggctgcaggcg
atgggcgccgagatcaccatcgagcacggctacatcgaggcgcgcgccacgcgcctgaag
ggcgcgcgcctcgtcaccgacatgatcacggtgaccggcaccgagaacctgctgatggcc
gccacgctcgccgacggcgagaccgtgatcgagaacgccgcgcgcgagcccgaggtgacc
gacctcgccaacctgctggtggcgatgggggcgaggatcgacgggatcggcaccgaccgg
ctcgtgatccagggcgtcgagcggctgcacggcgcgagccacgcggtcgtgcccgaccgc
atcgaggccggcaccttcctttgcgcggcggcggccgcgggcggtgagctcacgctgcgc
ggcatgcgcgcgaacctgctcgacgcggtgctcggcaagctgcgcgagaccggcgccaag
ctcgacgagcgcgacgacgcgctgcgcgtgacgatggaccggcgcccggccgcggtggcg
atccgcacctccgaatatccggccttcccgaccgacatgcaggcgcagttcatgaccctg
aacgcggtggccgccggcaccgcgcacgtcgtcgagaccatcttcgagaaccgcttcatg
cacgtgcaggagctgaaccggctcggtgccgacatcgtggtggacggcaacacggcgctc
gtcaccggcgtgacgcagctctcgggcgcacgcgtgatggccaccgacctgcgcgcctcg
gcgagcctcgtgatcgcggggctgtgcgctgacggcgagaccgtcatcgaccgcatctac
catctcgatcgcggctatgatcggatggagaccaagctgaacgcagttggcgccgacgtg
cgccgcatcaccgggagtgccgcatga

DBGET integrated database retrieval system