KEGG   Burkholderia glumae: bglu_1g03310Help
Entry
bglu_1g03310      CDS       T00905                                 

Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bgl  Burkholderia glumae
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bgl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bgl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:350465..351790
Genome map
AA seq 441 aa AA seqDB search
MPIKIRKLDSRSEGFGAALRAVLAFEASEDEAIERSVAGILADVKVRGDAAVLDYTNRFD
RLGAPSVAALELRQDALEAALETLEPKRRAALEAAAARVRGYHEKQKLECGSHSWQYTES
DGTVLGQKVLPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVKNDLV
LAAAYLGGVDRVFTIGGAQAVAALAYGTETVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPHWVAMDLFSQAEHDELAQSILLCPDAGFIERVEKAIDELLPAM
PREAVIRASLEGRGALITVRDMAEACKIANEIAPEHLEISALEPQQWGKLIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSLIEVSADGAHTLGEIASELA
YGEGLQAHAKSAEYRMRNHGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaagattcgcaaactcgattcgcgcagcgagggcttcggcgccgcgctgcgc
gcggtgctcgccttcgaggcgagcgaggacgaggcgatcgagcgctcggtcgcggggatt
ctcgccgacgtgaaggtgcgcggcgacgcggccgtgctcgactacacgaaccgcttcgac
cggctcggcgcgcccagcgtggccgcgctggagctgcgccaggacgcgctcgaggccgcg
ctcgagacgctcgagccgaagcgccgcgcggcgctcgaggcggccgccgcgcgggtgcgc
ggctatcacgagaaacagaagctcgaatgcggcagccatagctggcagtacaccgagtcc
gacggcacggtgctgggccagaaggtgctgccgctcgatcgcgtcggcctgtacgtgccg
ggcggcaaggccgcctatccgtcgtcggtgctgatgaacgcgattccggcccgggtggcc
ggggtcggcgagatcgtgatggtggtgcccacgcccgacggcgtgaagaacgacctcgtg
ctcgcggccgcctatctcggcggcgtcgatcgcgtgttcaccatcggcggggcgcaggcg
gtggccgcgctcgcctacggcaccgagacggtgccggccgtcgacaagatctgcggcccc
ggcaacgcctacgtggcctcggccaagcgccgcgtgttcggcaccgtgggcatcgacatg
atcgccgggccgtccgagatcctcgtgctctgcgacggcaccaccgatccgcactgggtc
gcgatggacctgttctcgcaggccgagcacgacgaactggcgcagtcgatcctgctgtgc
ccggacgcgggcttcatcgagcgcgtcgagaaggcgatcgacgagctgctgccggccatg
ccgcgcgaggccgtgatccgcgcctcgctggaagggcgcggcgcgctgatcacggtgcgc
gacatggccgaggcctgcaagatcgccaacgagatcgcgcccgagcacctcgagatctcg
gcgctcgagccgcagcaatggggcaagctgattcgccatgccggcgcgatcttcctcggc
cgctacacgagcgagagcctcggcgactactgcgccgggccgaaccacgtgctgccgacc
tcgcgcacggcgcgcttctcgtcgccgctgggcgtctacgacttcatcaagcgctcgagc
ctgatcgaggtcagcgccgacggcgcgcacacgctcggcgagatcgcctcggagctggct
tacggcgaggggctgcaggcgcacgcgaaaagcgccgaataccggatgcgcaaccacggc
aactga

DBGET integrated database retrieval system