KEGG   Burkholderia glumae: bglu_1g05300Help
Entry
bglu_1g05300      CDS       T00905                                 

Definition
guanyl-specific ribonuclease Sa
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     bglu_1g05300
Messenger RNA biogenesis [BR:bgl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     bglu_1g05300
Transfer RNA biogenesis [BR:bgl03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    bglu_1g05300
 Prokaryotic Type
    bglu_1g05300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:559525..559947
Genome map
AA seq 140 aa AA seqDB search
MARKWLRNGALASVFALVALGSAGLPAGSAISLAYAREAVSSMAPVGTIPTSRLPSEAVT
TLGLIAAGGPYPYPKDGAVFGNFERILPKMRRGYYHEYTVPTPRARNRGAKRIVCGGPLR
RVDNCYYTDDHYASFKRIVE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtctgttttcgcgctcgtcgcactg
ggtagcgctggcttgccggcaggcagtgcgatttccctggcgtacgctcgggaagccgtc
tccagcatggcgcccgtcggcaccattcccacttcccggttgccgagcgaagccgtgacg
acgcttggcctgattgccgccggcggcccttatccgtatccgaaagacggggccgtgttc
ggcaatttcgagcgcattctgccgaagatgcggcgcggctattaccacgagtacacggtg
ccgacgccgcgcgcgcgcaatcgcggcgcgaagcgcatcgtctgcggcggtccgctgcga
cgcgtcgacaactgttattacaccgacgaccactacgccagttttaaacgtattgttgaa
tga

DBGET integrated database retrieval system