KEGG   Burkholderia glumae: bglu_1g06390Help
Entry
bglu_1g06390      CDS       T00905                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bgl  Burkholderia glumae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bglu_1g06390
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     bglu_1g06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(681146..681679)
Genome map
AA seq 177 aa AA seqDB search
MTVAYLGLGANLGDARQALKDAVVCLAQQCTSITVIGKSSLYRTAPVDAGGDDYYNCAVK
VDTRLPARELLRLCQQIEHHFGRERPFPNAPRTLDIDILLYGDHLIDEPDLVVPHPRLTA
RAFVLVPLLELDPALMIPSRGAAQAFLAAVADQRIEKVQTCQCLLAMKSANESRRCR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcgggctgggcgcgaatctcggcgatgcgcgccaggcgttgaag
gacgcggtggtctgcctcgcgcagcaatgcacgtcgatcaccgtgatcggcaagtcgagc
ctgtaccggacggcccccgtggatgccggcggcgacgactactacaactgcgccgtcaag
gtcgacacgcgtttgccggcccgtgaattgctccggctctgccagcagatcgagcaccat
ttcggccgcgagcggccgttccccaatgcgccgcgtacgctcgacatcgacatcctgctg
tacggcgaccatctgatcgacgagcccgatctggtcgtgccgcacccgcgcctgaccgcg
cgcgcgttcgtgctggtgccgctgctcgaactcgatccggcgctcatgattccctcgcgg
ggcgccgcccaggcgttcctcgccgcggtggccgaccagcgcatcgagaaggtgcagacc
tgccagtgcctgctggcgatgaagagcgcgaacgagtcgcgccgctgccgatga

DBGET integrated database retrieval system