KEGG   Burkholderia glumae: bglu_1g07280Help
Entry
bglu_1g07280      CDS       T00905                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bgl  Burkholderia glumae
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bgl00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bgl00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:786329..786880
Genome map
AA seq 183 aa AA seqDB search
MAIQVTATALPEVKLIEPKVFGDARGFFYESFTAREFAASVCEGVEFVQDNHSRSARGVL
RGLHYQIEHAQGKLVRVVEGSVFDVAVDIRKHSPNFGKWVGAELSGENHLQMWVPPGFAH
GFVVLSETAQFLYKTTDYWYPEFERSIIWNDPEIGIEWPIDFEPKLAAKDAAGTRFAQAE
VYA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaggtaaccgccacggcgcttcccgaagtcaagctcatcgagccgaaggtg
ttcggcgacgcgcgcgggttcttctacgagagcttcaccgcgcgcgagttcgcggcgagc
gtgtgcgaaggcgtcgagttcgtgcaggacaatcattcgcgctccgcccgtggcgtcctg
cgcggcctgcactatcagatcgagcatgcgcagggcaagctggtgcgcgtggtcgagggt
tcggtgttcgatgtcgccgtcgatatccgcaagcactccccgaatttcggcaaatgggtg
ggcgcggagctgtccggcgagaatcacctgcaaatgtgggtgccgcccggcttcgcgcac
ggtttcgtggtgctgtcggagaccgcgcagtttctctacaagacgaccgattactggtat
ccggagttcgaacgcagcatcatctggaacgatcccgagatcggcatcgaatggccgatc
gacttcgagccgaagctggccgccaaggatgcggccggtacgcgcttcgcgcaggccgaa
gtctacgcctga

DBGET integrated database retrieval system