KEGG   Burkholderia glumae BGR1: bglu_1g07660Help
Entry
bglu_1g07660      CDS       T00905                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bgl  Burkholderia glumae BGR1
Brite
Enzymes [BR:bgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     bglu_1g07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS PrmA Ubie_methyltran Methyltransf_23 RrnaAD Methyltransf_12 Met_10 Methyltransf_18 Methyltransf_4 Cons_hypoth95 Methyltransf_32 Methyltransf_3 UPF0146 DUF43 CMAS tRNA_U5-meth_tr Methyltransf_24 ADH_zinc_N UPF0020 Methyltr_RsmB-F TPMT DUF938 Spermine_synth Methyltransf_9 Methyltransf_16 Methyltransf_15 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACR27958
UniProt: C5ABZ7
Position
1:complement(829817..830470)
Genome map
AA seq 217 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDQEVLSLLSVVKREQYVPAVYRDLAFADLELPLPGGQKM
LAPRVEARMLQELAVKKHESILEIGAGSGYMAALLAHRGQHVVTVDIDPELVRFATDNLR
NNGVTNVEVVLGDAARGLPEKGPYDVICVSGGLPMVPQELLEQLKVGGRLAAFVGSRPVM
KAQIITRIDDKQFRVADVFETYVDHLVNAMEPSRFRF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaaaatgcgcgcttcaacatgatcgaacagcagatccggccgtgggacgtg
ctggatcaggaggtcctgagcctgctgtcggtcgtcaagcgtgaacagtacgtgcccgcg
gtgtatcgcgatctcgcgttcgccgatctcgaactgccgctgcccggcggccagaagatg
ctcgcgccgcgcgtcgaggcgcgcatgctgcaggaactcgcggtgaagaagcacgagagc
atcctcgaaatcggcgccggctccggctacatggccgcgctgctcgcccaccggggccag
cacgtggtgacggtcgacatcgatcccgaactcgtgcggttcgccaccgacaatctgcgc
aacaacggcgtgacgaacgtcgaggtggtgctcggcgacgccgcgcgcggcctgcccgag
aaaggcccctacgacgtgatctgcgtatcgggcggcctgccgatggtgccgcaggaactg
ctcgaacagctgaaggtgggcggccggctcgccgccttcgtcggctcgcggccggtcatg
aaggcgcagatcatcacgcgcatcgacgacaagcagttccgcgtcgccgacgtgttcgaa
acctacgtcgaccacctcgtcaacgcgatggagccgtcgcgcttccgcttctga

DBGET integrated database retrieval system