KEGG   Burkholderia glumae BGR1: bglu_1g08040Help
Entry
bglu_1g08040      CDS       T00905                                 

Definition
(GenBank) bifunctional glucokinase/RpiR family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00052  Galactose metabolism
bgl00500  Starch and sucrose metabolism
bgl00520  Amino sugar and nucleotide sugar metabolism
bgl00521  Streptomycin biosynthesis
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g08040
   00052 Galactose metabolism
    bglu_1g08040
   00500 Starch and sucrose metabolism
    bglu_1g08040
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_1g08040
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bglu_1g08040
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    bglu_1g08040
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bglu_1g08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK F_bP_aldolase LacI HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ACR27987
UniProt: C5ACF7
Position
1:complement(865274..867190)
Genome map
AA seq 638 aa AA seqDB search
MSTGAQTKPAAGQHADGPRLLADIGGTNARFALEVGPGEITQIRVYPGADYPTLTDAIRK
YLKDAKIGRVNHAAIAIANPVDGDQVRMTNHDWSFSIEATRRALGFDTLLVVNDFTALAM
ALPGLTDAQRQQVGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHASFAPM
DEREDLVMQYARKKFAHVSFERVCAGPGIELVYRALAGRDKKRVPSGFGTPEVVERAHAG
DALALEAVDVFCAILGTFAGNLAVTLGSLGGVYIGGGVVLKLGELFLKSRFRERFEQKGR
FSEYLANVPTYLITADYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRV
ADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMS
HSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVAQAIEILNGARRIEFYGLGNSNI
VAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQA
GAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAP
NAEITEAVAQARSRAGDDESADVLDWLSHGAAPAAARE
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaaccggcagcgggccagcacgccgacggcccgcgcctg
ctggccgacatcggcggcaccaacgcgcgcttcgcgctcgaggtcggccccggcgagatc
acgcagatccgcgtctaccccggcgccgactacccgacgctgaccgacgcgatccgcaag
tatctgaaggacgccaagatcggccgcgtcaaccacgcggcgatcgcgatcgcgaacccg
gtcgacggcgaccaggtgcgcatgaccaaccacgactggagcttctcgatcgaggccacg
cgccgcgcgctgggcttcgacacgctgctcgtggtcaacgatttcaccgcgctcgcaatg
gcgctgcccggcctgaccgacgcgcagcgccagcaggtgggcggcggcacgcgccgccag
aacagcgtgatcggcctgatggggccgggcaccgggctcggcgtgtcgggcctgatcccg
gccgacgaccgctggatcgcgctcggcagcgaaggcggccatgccagcttcgcgccgatg
gacgagcgcgaggacctggtcatgcagtacgcgcgcaagaagtttgcgcacgtctcgttc
gagcgcgtttgcgcggggcccggcatcgagctcgtctaccgggcactggccgggcgcgac
aagaagcgcgtgccgtcgggcttcggcacgcccgaggtggtcgagcgggcccatgcgggc
gatgcgctcgcgctcgaggcggtggacgtgttctgcgcgatcctcggcaccttcgcgggc
aacctcgccgtcacgctcggctcgctcggcggcgtctacatcggcggcggcgtggtgctg
aagctcggcgagctgttcctgaagtcgcgctttcgcgagcgcttcgagcagaaagggcgc
ttttccgagtacctcgcgaacgtgccgacctacctgatcaccgccgactatccggcattc
ctcggcgtctcggcgatcctcgccgagcagttgtcgaaccgcacgggcggcgcctcgtcg
gccgtgttcgagcggatccgccagatgcgcgacgcgctcacgccggccgagcgccgcgtg
gccgacctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtccgacttcaagctcaagctcgccaccggcctgaccggcaccatcccgatgagc
cacagccaggtccatctcggcgacacggccaccgacttcggcgcgaaggtgctcgacaac
acggtctcggcgatcctgcagctgcgcgagcacctgaacttcgagcacgtcgcgcaggcc
atcgagatcctgaacggcgcgcggcgcatcgagttctacgggctcggcaactcgaacatc
gtcgcgcaggacgcgcattacaagttcttccgcttcgggattccgaccatcgcctacggc
gacctctacatgcaggccgcctcggccgcgctgctcggcaagggcgacgtgatcgtggcc
gtctcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgaagtggcgatgcaggcc
ggcgccaaggtgatcgcgatcacctccagcaacacgccgctcgccaagcgcgcgacggtg
gcgctggagaccgaccacatcgagatgcgcgagtcgcagctgtcgatgatctcgcggatc
ctgcacctcgtgatgatcgacatcctggcggtgggcgtcgcgatccggcgcgccgcgccg
aacgccgagatcaccgaggcggtcgcgcaggcgcgctcgcgtgccggcgacgacgaatcg
gccgacgtgctcgactggctcagccacggcgcggcgcccgcggccgcgcgcgaatga

DBGET integrated database retrieval system