KEGG   Burkholderia glumae BGR1: bglu_1g08300Help
Entry
bglu_1g08300      CDS       T00905                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00230  Purine metabolism
bgl01100  Metabolic pathways
Module
bgl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    bglu_1g08300
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     bglu_1g08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 AAA_16 AAA_29 Septin AAA_23 cobW GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: ACR28013
UniProt: C5ACI3
Position
1:895610..896284
Genome map
AA seq 224 aa AA seqDB search
MTESNRDAHALHAGAYPGNLFMVVAPSGAGKSTLVNALLAQDDEIRLSISYTTRKPRPGE
QDGEHYHFTSVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMASGRDVLLEIDWQGA
QQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHASEAEYVVI
NEHFDTALAELRRIVAATRLRFASQYARHTELFIELGIHLPHAE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcgaaccgagacgcgcacgcgctgcatgccggcgcgtatcccggcaacctg
ttcatggtggtggccccgtcgggcgccggcaagtcgacgctcgtgaacgcgctgctcgcg
caggacgacgagatccgcctgtcgatctcgtacacgacgcgcaagccgcgcccgggcgag
caggacggcgagcactatcacttcacgagcgtcgaggacttccgcgcgcgccatgcggcg
cacgaattcctcgaaagcgccgaggtgcacggcaactactacggcacctcgcgcgtctgg
atcgaggagcagatggcgagcgggcgcgacgtactgctcgagatcgactggcagggcgcg
cagcaggtcaagaagcagttccgcaacgcggtcgggatcttcatcctgccgccctcgctc
gcggccctcgaggaacgtctgaagaaacgcggccaggacgagccgaacgtgatcacgcgg
cgcctgctcgcagcgggcagcgagatcgcgcacgcttccgaggccgaatacgtggtgatc
aacgagcacttcgacacggcactggccgagttgcggcgcatcgtggccgccacgcggctg
cgcttcgcctcgcaatacgcacgccacaccgagcttttcatcgagctcggcatccatctc
ccgcacgccgagtga

DBGET integrated database retrieval system