KEGG   Burkholderia glumae: bglu_1g09690Help
Entry
bglu_1g09690      CDS       T00905                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bgl  Burkholderia glumae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_1g09690
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    bglu_1g09690
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bglu_1g09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1044037..1045065
Genome map
AA seq 342 aa AA seqDB search
MKPTPGPVMLDVVGTTLTRDDARRLAHPRTGGVILFARHFESREQLCALTEAIRAVRDDL
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATRAATAVGYVLAAELRACGID
LSFTPVLDLDYGRSKVIGDRAFHRDPRVVTLLAKSLSHGLALTGMANCGKHFPGHGYAEA
DSHVALPTDDRPLEQILKLDAAPYDWLGLALAAVIPAHVIYTQVDSRPAGFSSIWLQRVL
RERLGFTGAVFSDDLSMEAARAGGTLAQAADAALEAGCDMVLVCNQPEAAERVLEEMRAE
VSPESARRIRRLRPRGKASGWDKLMRRPEYQRACALLRETFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgacccccggccccgtcatgctcgacgtcgtcggcacgacgctcacgcgcgac
gatgcgcggcgcctcgcgcatccacgcacgggcggcgtgatcctgttcgcgcgccacttc
gaaagccgcgagcagctgtgcgcgctgaccgaggcgatccgcgccgtgcgcgacgacctc
ctgatcgccgtcgatcacgagggcgggcgcgtgcagcgttttcgcaccgacggcttcacg
gtgctgccggcgatgcgccggctcggcgagctgtgggacaaggacgtgctgcacgccacg
cgcgcggcgaccgcggtcggctacgtgctcgccgccgagttgcgcgcctgcgggatcgac
ctcagcttcacgccggtgctcgatctcgactacggccgctcgaaggtgatcggcgaccgg
gcgttccatcgcgatccgcgcgtcgtcacgctgctggcgaagagcctgagccacgggctc
gcgctgaccggcatggcgaactgcggcaagcatttccccggccacggctacgccgaggcc
gattcgcacgtcgcgctgccgaccgacgatcgcccgctcgaacagatcctcaagctcgac
gccgcgccgtatgactggctcgggctggcgctggccgcggtgattccggcgcacgtgatc
tacacgcaggtggattcgcggccggccggattctcgtcgatctggctgcagcgcgtgctg
cgcgagcggctcggcttcaccggtgcggtgttcagcgacgatctttccatggaagcggcg
cgcgcgggcggcacgctggcgcaggcggccgacgcggcgctcgaggccggttgcgacatg
gtgctggtctgcaaccagccggaagccgccgagcgggtgctcgaggagatgcgggcggag
gtgtcgccggaatcggcgcggcggatccgtcggctgcggccgcgcggcaaggcgtcgggc
tgggacaagctgatgcgccggcccgagtaccagcgtgcctgcgcgctgctgcgcgagacg
ttcggctga

DBGET integrated database retrieval system