KEGG   Burkholderia glumae: bglu_1g10360Help
Entry
bglu_1g10360      CDS       T00905                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bgl  Burkholderia glumae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bglu_1g10360
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     bglu_1g10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1127462..1129783
Genome map
AA seq 773 aa AA seqDB search
MKDLTEPFGFVGGLAERLPEPADFGLALAEGFARRIGMLSRRLGAPADAARWAARAAFAA
SRATAAGHVCIALGALAARYAVSLDQVRAELAASGVTAFGRAPRGADCPLVVDAQGRLYL
ARYFDYETRLADALVAHARAARPEADGALAPARLRESLARYFAPPREGEIDWQRVAAVVA
LGGRLTIVSGGPGTGKTTTVVGVIACLIELQPALRIALAAPTGKAAQRMQEALHARAAGL
PAEFAAQLPRTSYTLHRLLGWLPGGRFRHHRDNPLPYDLVVVDEASMIDVALAAHLLDAL
APGARLVLLGDKDQLAAVEAGAVFAELSARPAFSAAGCERIAAALGVSPAAFVAALPDEA
RATAPAGATQGANRAGADGRPASAAAPRRRGARPAPPEAGGMPVQRSLFDFDEVAASTDA
SACAAESASRAGQAGFADAPLEAWIEPDELAWLDAWRIDEVQAARFDAGRTGMPAVPGPG
REPASHADAPAVGEPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDAQAALDALSTQADA
AARFIDDGGDALAAATIERLADGFAAYGRALREVLAGGEPDPLPLFDVLNRFRVLCATRT
GARGADEINLRVAALVRRAVGVPLAVGAHWFAGRPVMVTRNDYALGLFNGDIGIALHDAQ
GALRVWFRGADGLARAVSPAALPPHDTAFALTVHKSQGSEFDEAALVLPAAFGRVLSREL
VYTAITRARSRVQVIGPRAVLAQAIATRTQRDSGLAARIADAAQAAAEAEARH
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatctgaccgaaccgttcggcttcgtcggcggcctcgccgagcgcctgcccgag
cctgccgatttcgggctcgcgctcgccgagggcttcgcgcgccgcatcgggatgctgtcg
cgccggctcggcgcgcccgccgatgcggcgcgctgggccgcgcgcgcggcgttcgcggcg
agccgcgccaccgcggcggggcatgtctgcatcgcgctcggtgcgctcgccgcgcgctac
gccgtgtcgctcgaccaggtgcgcgccgagctggccgcgagcggtgtgaccgcgttcggc
cgcgcgccgcgcggcgccgactgtccgttggtggtggacgcgcaggggcggctctacctc
gcccgctatttcgactacgagacgcggctcgccgacgcgctggtcgcgcacgcccgcgcg
gcgcgtcccgaggcggacggcgcgctggcgccggcgcgcctgcgcgagagcctcgcgcgc
tacttcgcgccgccgcgcgagggcgagatcgactggcagcgcgtggcggccgtggtcgcg
ctcggcggccgcttgacgatcgtcagcggcgggccgggcaccggcaagaccaccaccgtg
gtcggcgtgatcgcctgcctgatcgagctgcagccggcgctgcgcatcgcgctcgcggcg
ccgaccggcaaggccgcgcagcgcatgcaggaggcgctgcacgcgcgcgcggccgggctg
cccgccgagttcgccgcgcaactgccgcgcacctcgtacacgctgcaccggctgctcggc
tggctgcccggcggccggttccgccaccaccgcgacaacccgctgccctacgatctcgtc
gtggtcgacgaggcatcgatgatcgacgtcgcgctggcggcccacctgctcgatgcgctc
gcgcccggcgcgcggctcgtgctgctcggcgacaaggaccagctcgccgccgtggaggcg
ggcgcggtgttcgccgaactgagcgcacggccggcattcagcgcggccggctgcgagcgg
atcgccgcggcgctcggcgtgagcccggcggccttcgtcgccgcgctgcccgacgaggca
cgcgcgacggcgccggccggcgcaacgcagggcgcgaaccgggccggtgccgacggccgg
ccggcctcggccgccgcgccgcggcggcgcggggcacgcccggcgccgcccgaggctggc
ggcatgccggtgcagcgctcgctgttcgatttcgacgaggtcgccgcgagcaccgatgcg
tccgcttgcgcagccgaatcggcgagccgggccggccaggcaggcttcgccgacgcgccg
ctcgaggcgtggatcgaacccgacgagctggcgtggctcgatgcatggcgcatcgacgag
gtccaggcggcgcggttcgacgcggggcgcaccggcatgcccgcggtgccggggcccggg
cgcgagccggcaagccacgccgatgcgcccgccgtgggcgagccgctcgccgactgcgtg
gtctggctcgaacgcaactaccgcttcggcctcgattcgccgatcggccggctgtcgctg
gcgatccggcgcggcgacgcgcaggccgcgctcgacgcgctatcgacgcaggccgacgcc
gccgcgcggttcatcgacgacggcggcgacgcgctggccgccgccaccatcgagcgcctt
gccgacggcttcgccgcctatggccgggccctgcgcgaggtgctcgccggcggcgagccg
gacccgctgccgctgttcgacgtgctgaaccgcttccgggtgctctgcgcgacgcgcacc
ggcgcgcgcggggccgacgagatcaatctgcgcgtggcggcgctggtgcggcgcgcggtg
ggcgtgccgcttgccgtgggcgcgcactggttcgccggccggccggtgatggtcacgcgc
aacgactacgcgctcggcctgttcaatggcgatatcggtatcgcgctgcacgacgcgcag
ggggcgctgcgggtctggttccggggcgccgacgggctcgcgcgcgccgtctcgccggcc
gcgctgccgccgcacgatacggccttcgcgctgaccgtccacaagtcgcagggctcggaa
ttcgacgaggccgcgctggtgctgccggccgcgttcggccgcgtgctgtcgcgcgaactg
gtctacaccgccatcacgcgggcccgctcgcgcgtgcaagtgatcggcccgcgcgccgtg
ctcgcgcaggcgatcgcgacccgcacgcaacgcgattcgggcctcgccgcgcgcatcgcc
gatgccgcgcaggcggccgccgaggccgaggcacggcactag

DBGET integrated database retrieval system