KEGG   Burkholderia glumae: bglu_1g10690Help
Entry
bglu_1g10690      CDS       T00905                                 

Definition
pyruvate dehydrogenase (lipoamide)
Orthology
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bgl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bgl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bgl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1169541..1170653)
Genome map
AA seq 370 aa AA seqDB search
MDTMLLKRTRHTEHAAQACIRCIEDTRGDAGEHDSPLLTVSALIRDLHQDATVDGQFWFV
DDRAEQQQRNAAIGAWPLWISERARNDERPLFYLTQSPTSRHLSMLTAQTAERGIILNDI
ESSPSRWAKGAHPWLPLWLASNRQCMPFDPACGEEVKAIVAGALHDLYMKGEPGFCYLTL
HGEPIEALRCDRTQAYLGMYRLSEPKASQPQIRLLGAGLVLREVRAAAQLLKDDWGVDSE
VWSCPSYTRLARDSADAQRWNASLGSCARRTSHLHACLNRSRQPVLAVTAYAEFVAAQLG
PYLDAPFSAIGADTFAPNQCPDRRWIAYRALDALARQGQLAGADLARALDRYGLGELVPR
QARPDGGACA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgcttctcaaacgcacccgacacacggagcatgccgcgcaagcctgcatc
cgctgcatcgaggacacccgcggcgacgcaggcgaacacgattcgcccctgctcaccgtg
tcggcgctgatccgcgacctgcatcaggacgccacggtcgacggccagttctggttcgtc
gacgatcgtgccgagcagcagcagcgcaacgcggcgatcggtgcctggccgctgtggatc
agcgagcgagcgcgcaacgacgagcgcccgctgttctacctcacgcagtcccccacctcg
cgccatctctcgatgctcaccgcccagaccgcggagcgcggcatcatcctcaacgacatc
gaatcgtcgccgtcgcgctgggccaagggcgcgcacccgtggctgccgctctggctcgcc
tcgaaccgccagtgcatgccgttcgatccggcctgcggcgaggaggtcaaggcgatcgtg
gccggcgcgctgcacgatctctacatgaagggcgagcccggcttctgctatctgacactg
cacggcgagcccatcgaggcgctgcgctgcgaccggacccaggcctatctcggcatgtat
cgcctgtcggagccgaaggcgtcccagccgcagatccggctgctcggcgccgggctggtg
ctgcgcgaggtgcgtgccgcggcgcagttgctcaaggacgactggggcgtcgacagcgag
gtgtggagctgtccgagctacacccggctcgcgcgcgactcggccgacgcgcagcgctgg
aacgccagcctcggcagctgtgcgcgccgaacctcgcacctgcatgcctgcctgaaccgc
agccggcagccggtcctcgccgtgacggcctacgccgagttcgtcgccgcccagctgggc
ccctatctcgacgcgccgttcagcgcgatcggcgccgacacgttcgcgccgaaccagtgt
ccggaccggcgctggatcgcctaccgcgccctcgatgcgctcgcccggcaagggcagctc
gccggcgccgacctggcgcgggccctcgaccgctacgggctcggcgaactcgtcccgcgc
caagcgcggcccgacggcggcgcctgcgcgtga

DBGET integrated database retrieval system