KEGG   Burkholderia glumae: bglu_1g10690Help
Entry
bglu_1g10690      CDS       T00905                                 

Definition
pyruvate dehydrogenase (lipoamide)
Orthology
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bglu_1g10690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g10690
   00020 Citrate cycle (TCA cycle)
    bglu_1g10690
   00620 Pyruvate metabolism
    bglu_1g10690
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     bglu_1g10690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1169541..1170653)
Genome map
AA seq 370 aa AA seqDB search
MDTMLLKRTRHTEHAAQACIRCIEDTRGDAGEHDSPLLTVSALIRDLHQDATVDGQFWFV
DDRAEQQQRNAAIGAWPLWISERARNDERPLFYLTQSPTSRHLSMLTAQTAERGIILNDI
ESSPSRWAKGAHPWLPLWLASNRQCMPFDPACGEEVKAIVAGALHDLYMKGEPGFCYLTL
HGEPIEALRCDRTQAYLGMYRLSEPKASQPQIRLLGAGLVLREVRAAAQLLKDDWGVDSE
VWSCPSYTRLARDSADAQRWNASLGSCARRTSHLHACLNRSRQPVLAVTAYAEFVAAQLG
PYLDAPFSAIGADTFAPNQCPDRRWIAYRALDALARQGQLAGADLARALDRYGLGELVPR
QARPDGGACA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgcttctcaaacgcacccgacacacggagcatgccgcgcaagcctgcatc
cgctgcatcgaggacacccgcggcgacgcaggcgaacacgattcgcccctgctcaccgtg
tcggcgctgatccgcgacctgcatcaggacgccacggtcgacggccagttctggttcgtc
gacgatcgtgccgagcagcagcagcgcaacgcggcgatcggtgcctggccgctgtggatc
agcgagcgagcgcgcaacgacgagcgcccgctgttctacctcacgcagtcccccacctcg
cgccatctctcgatgctcaccgcccagaccgcggagcgcggcatcatcctcaacgacatc
gaatcgtcgccgtcgcgctgggccaagggcgcgcacccgtggctgccgctctggctcgcc
tcgaaccgccagtgcatgccgttcgatccggcctgcggcgaggaggtcaaggcgatcgtg
gccggcgcgctgcacgatctctacatgaagggcgagcccggcttctgctatctgacactg
cacggcgagcccatcgaggcgctgcgctgcgaccggacccaggcctatctcggcatgtat
cgcctgtcggagccgaaggcgtcccagccgcagatccggctgctcggcgccgggctggtg
ctgcgcgaggtgcgtgccgcggcgcagttgctcaaggacgactggggcgtcgacagcgag
gtgtggagctgtccgagctacacccggctcgcgcgcgactcggccgacgcgcagcgctgg
aacgccagcctcggcagctgtgcgcgccgaacctcgcacctgcatgcctgcctgaaccgc
agccggcagccggtcctcgccgtgacggcctacgccgagttcgtcgccgcccagctgggc
ccctatctcgacgcgccgttcagcgcgatcggcgccgacacgttcgcgccgaaccagtgt
ccggaccggcgctggatcgcctaccgcgccctcgatgcgctcgcccggcaagggcagctc
gccggcgccgacctggcgcgggccctcgaccgctacgggctcggcgaactcgtcccgcgc
caagcgcggcccgacggcggcgcctgcgcgtga

DBGET integrated database retrieval system