KEGG   Burkholderia glumae: bglu_1g11430Help
Entry
bglu_1g11430      CDS       T00905                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bgl  Burkholderia glumae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bglu_1g11430
Enzymes [BR:bgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     bglu_1g11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1254585..1255448
Genome map
AA seq 287 aa AA seqDB search
MPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALRQAERMLADGADLIDIG
GESTRPGAPPVPLDEELSRVLPVVEALQAMRVPLSIDTYKPAVMRAALAAGADLINDIWG
FRQPGALEAVSGSNCGLCAMHMLGEPRTMQLGEPDYLDVVAEVRGFLADRAAALVSAGIA
PQRISVDPGFGFGKATVEHNYALLAKLADTAPARPDGARYPILAGMSRKSMLGVLIGRPA
AERVAASVAAAVCAAERGAAIIRVHDVAPTVDALKIWGAVRAAAQDA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccgctgcaatgcggccgcttcacgctgacgttcgagcgcccgctcgtgatg
ggcatcctcaacgtcacccccgactcgttttccgacggcggtcgctacgtggcccgtgac
gccgcgctgcgccaggccgaacgcatgcttgccgacggcgccgacctgatcgacatcggt
ggcgagtcgacgcggcccggcgcgccgcccgtgccgctcgacgaggaactgtcacgcgtg
ctccccgtcgtcgaggccttgcaggcgatgcgcgtgccgctgtcgatcgacacctacaag
cctgcggtgatgcgcgccgcgctcgcggccggtgccgatctgatcaatgacatctggggc
tttcgccagcccggcgccctcgaggcggtgagcggctcgaattgcgggctctgcgcgatg
cacatgctcggcgaaccgaggacgatgcaactcggcgaacccgattacctcgacgtggtg
gccgaggtgcgcggctttctcgccgatcgcgcggccgcgctcgtttcggccggcatcgcg
ccgcagcgaatcagcgtcgatcccggcttcggcttcggcaaggccacggtcgaacacaac
tacgcgctgctggcgaagctggccgacaccgcgccggcgcgcccggacggcgcgcgctat
ccgattctcgccggcatgtcgcgcaagtcgatgctcggtgtgctgatcggccggccggcg
gccgagcgcgtcgccgcgagcgtggcggcggcggtctgcgcggccgaacgcggcgcggcc
atcattcgcgtgcacgacgtcgcgccgacggtcgacgcattgaagatctggggcgccgtg
cgggccgcggcgcaagacgcatag

DBGET integrated database retrieval system