KEGG   Burkholderia glumae: bglu_1g12050Help
Entry
bglu_1g12050      CDS       T00905                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     bglu_1g12050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1316479..1316901
Genome map
AA seq 140 aa AA seqDB search
MNTFDEAALIRELTRDEGRRLKPYVDTVGKITIGVGRNLTDVGISDDECDLLLTHDVASA
VAWLDAELPWWCRLDPVRQRVVVNMAFNLGAKLLTFKNTLGAMERGDYAVAAAGMLASKW
ARQVGARADRLAGMMRAGRE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgttcgatgaagcagcgctgattcgggagctgacgcgggacgaggggcggcgg
ctgaagccctatgtcgacacggtcggcaagatcacgatcggggtggggcggaacctgacg
gacgtcggcatcagcgatgacgagtgcgatctgctgctgactcacgacgtcgcgagcgcg
gtggcctggctggatgccgagttgccttggtggtgcaggctcgatccagtccggcagcgg
gtggtcgtcaacatggcgttcaacctcggcgccaagctattgacgttcaagaacacgctc
ggcgcgatggagcgtggcgactacgccgtcgccgccgcgggcatgctggcttcgaagtgg
gcgcggcaggttggagcgcgtgcggatcggctcgcgggaatgatgcgagccggcagggag
tga

DBGET integrated database retrieval system