KEGG   Burkholderia glumae: bglu_1g12050Help
Entry
bglu_1g12050      CDS       T00905                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bgl  Burkholderia glumae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1316479..1316901
Genome map
AA seq 140 aa AA seqDB search
MNTFDEAALIRELTRDEGRRLKPYVDTVGKITIGVGRNLTDVGISDDECDLLLTHDVASA
VAWLDAELPWWCRLDPVRQRVVVNMAFNLGAKLLTFKNTLGAMERGDYAVAAAGMLASKW
ARQVGARADRLAGMMRAGRE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgttcgatgaagcagcgctgattcgggagctgacgcgggacgaggggcggcgg
ctgaagccctatgtcgacacggtcggcaagatcacgatcggggtggggcggaacctgacg
gacgtcggcatcagcgatgacgagtgcgatctgctgctgactcacgacgtcgcgagcgcg
gtggcctggctggatgccgagttgccttggtggtgcaggctcgatccagtccggcagcgg
gtggtcgtcaacatggcgttcaacctcggcgccaagctattgacgttcaagaacacgctc
ggcgcgatggagcgtggcgactacgccgtcgccgccgcgggcatgctggcttcgaagtgg
gcgcggcaggttggagcgcgtgcggatcggctcgcgggaatgatgcgagccggcagggag
tga

DBGET integrated database retrieval system