KEGG   Burkholderia glumae BGR1: bglu_1g12420Help
Entry
bglu_1g12420      CDS       T00905                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00630  Glyoxylate and dicarboxylate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01200  Carbon metabolism
Module
bgl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_1g12420
Enzymes [BR:bgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     bglu_1g12420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACR28401
UniProt: C5AES7
Position
1:complement(1358719..1360026)
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAKELQQQWEKDPRWKGIKRSYTAEDVVRLRGSLAVEHTIAKHGAEKLWKLINTE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDYFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTRENVAKLTAARLAADVMGVPAVLIARTDAEAADLITS
DIDDNDRPFLTGERTVEGFFRTKPGIDQAISRGLAYAPYADLVWCETGKPDLDYAKRFAE
AIHKQFPDKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHSLNYSMF
NLAHGYARTQMSAFVELQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGQKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcagcaacaggcgaaggaactgcagcagcagtgggagaaggatccgcgctgg
aaaggcatcaagcgcagctacacggcagaagacgtggtccgcctgcgcggctcgctggcc
gtcgagcacaccatcgcgaagcacggcgccgagaagctctggaagctgatcaacaccgag
ccgttcgtcaacgcgctcggcgcactgaccggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctacctgtcgggatggcaggtcgcgggcgatgccaacgtggccggc
gaaatgtatccggaccagtcgctttatccggccaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgaccagatccagtggtccgagggcaagaatcccggc
gacgaaggctacgtggactacttcgcgccgatcgtggccgacgcggaagccggcttcggg
ggcgtgctgaatgcgttcgagctgatgaaggccatgatcgaagccggtgcctcgggcgtg
catttcgaggaccagctcgcgtccgtgaagaagtgcggccacatgggcggcaaggtgctg
gtgccgacccgcgagaacgtcgcgaagctgacggccgcgcggctcgcagccgacgtgatg
ggtgtgccggccgtgctgatcgcgcgcaccgacgccgaggcagccgatctcatcacctcc
gacatcgacgacaacgaccggccgttcctgaccggcgagcgcaccgtcgaaggcttcttc
cgcaccaagcccggcatcgaccaggcgatttcgcgcggcctcgcctacgcgccctatgcc
gacctggtctggtgcgagaccggcaagcccgacctcgactacgccaagcgcttcgccgag
gcgatccacaagcagttcccggacaagctgctctcctacaactgctcgccgtcgttcaac
tggaagaagaacctcgatgacgcgaccatcgcgaagttccagaaggagctgggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccattcgctgaactactcgatgttc
aacctcgcgcacggctatgcacgcacccagatgagcgcgttcgtcgagttgcagcaggcc
gagttcgcggcggccgagaagggcttcaccgccgtcaagcaccagcgcgaagtgggcacc
ggctacttcgacgccgtcacgcagaccgtcgagcgcgaagcgtcgaccacggcactgcac
ggctcgaccgaggacgaacagttcttcgacggccagaaggtggcctga

DBGET integrated database retrieval system