KEGG   Burkholderia glumae BGR1: bglu_1g12580Help
Entry
bglu_1g12580      CDS       T00905                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00300  Lysine biosynthesis
bgl01100  Metabolic pathways
bgl01120  Microbial metabolism in diverse environments
bgl01230  Biosynthesis of amino acids
Module
bgl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    bglu_1g12580
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     bglu_1g12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACR28417
UniProt: C5AEU3
Position
1:complement(1376980..1378119)
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQIMIERLAAIGFDCETLASNGVTNLWAVRRGSAGR
DGKLLAFAGHTDVVPTGPLEQWSSPPFVPAHRDGRLYGRGAADMKTSLAGFVVASEEFVA
AHPDHRGSIAMLITSDEEGPATDGTVKVIEALAARGERLDYCIVGEPTSSATLGDMVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAERWDDGNEYFPPTTWQVSNL
HGGTGATNVIPGHVTLLFNFRFSTASTVDGLKARVHAILDRHGFEYALTWSVSGLPFLTP
RGELSDALERAILAETGVVTELSTTGGTSDGRFIARICPQVIEFGPPNGSIHKIDEHIEL
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccttgcccttaccgaacagctgatcgcccgcgcgtcggtgacgcccgac
gaccagcactgccagcagatcatgatcgagcgcctcgccgcgatcggcttcgactgcgag
accctcgcttcaaacggcgtgaccaatctgtgggccgtcaggcgcggcagcgccggccgc
gacggcaagctgctcgcgttcgcgggccacaccgacgtggtgccgaccggcccgctcgaa
cagtggagctcgccgcccttcgtccccgcgcatcgcgacggcaggctctacggccgcggt
gcggccgacatgaagacctcgctggccggcttcgtggtggcaagcgaggagttcgtggcc
gcccacccggaccatcgcggctcgatcgcgatgctgatcacgagcgacgaggaaggcccc
gccaccgacggcaccgtcaaggtgatcgaggcgctcgccgcgcgcggcgagcgcctcgac
tactgcatcgtcggcgagccgacctcgtcggccacgctcggcgacatggtcaagaacggc
cggcgcggctcgatgtcgggcgaactcgtcgtgaagggcgtgcaaggccacatcgcctat
ccgcatctggcgaagaatccgatccacctgctcgcgccggcgctggccgaactggccgcc
gaacgctgggacgacggcaacgagtatttcccgcccaccacctggcaggtctcgaacctg
cacggcggcaccggcgcgaccaacgtgattcccggccacgtcacgctgctgttcaacttc
cgcttctcgaccgcgagcacggtggacgggctcaaggcgcgtgtccacgcgatcctcgac
cggcacggcttcgaatacgcgctgacctggtcggtcagcgggctgccgttcctgacgccg
cgcggcgagctgtcggacgcgctggagcgggcgatcctcgccgaaaccggcgtggtgacc
gagctgtcgaccacgggcgggacctccgacggccgcttcatcgcgcggatctgcccgcag
gtgatcgagttcggcccgcccaacggctcgatccacaagatcgacgagcacatcgagctg
cgcttcgtcgacccgctcaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system