KEGG   Burkholderia glumae: bglu_1g12780Help
Entry
bglu_1g12780      CDS       T00905                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bgl  Burkholderia glumae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bgl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1400586..1401782
Genome map
AA seq 398 aa AA seqDB search
MQKRLTILGSTGSIGDSTLDVVARHPDRFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDA
ATAAQVEAKLRAAGSRTQVAYGPEALVQVAGAGGCDTVVAAIVGAAGLPSSLAAARAGKR
ILLANKESLVMSGSIFMDAVRDHGASLLPVDSEHNAIFQCMPRDIAEHGGIEKIIVTASG
GPFRTREPATLADVTPEQACKHPNWSMGRKISVDSATMMNKGLEVIEAHWIFGLPSSRID
VLIHPQSVIHSLVSYKDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTF
EQPDLERFPCLALAIQALDAGGVASTVLNAANELAVDAFLERRIGFMDIARTVDAVLNSL
TNREAAGLDDVLAADAEARRAAAAVIAGLPVPRAERAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgcctgactatcctcggttcgacgggttcgatcggagacagcacgctcgat
gtcgtcgcgcggcacccggaccgcttttcggtgtatgcgctgaccgcccatcgcaacggc
gacaagctcgtcgagcagtgcctgaggttcgcgcccgaggtggccgtggtcggcgatgcc
gccaccgccgcgcaggtcgaggccaagctgcgcgctgccggcagccgcacccaggtggcc
tacgggccggaggcgctggtccaggtcgccggagcgggcggctgcgacaccgtggtggcc
gcgatcgtcggcgcggcgggcctgccgtcgagcctcgccgccgcgcgtgcgggcaagcgg
attctgctggccaacaaggaatcgctggtgatgtcgggttcgatcttcatggacgcggtg
cgcgaccatggcgcgagcctgctgcccgtggacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacatcgcggagcacggcgggatcgagaagatcatcgtgacagcctcgggc
ggcccgtttcgtacccgtgagccggccacgctcgccgacgtgacgccggagcaggcctgc
aagcatccgaactggtcgatgggccgcaagatctcggtcgattcggccaccatgatgaac
aagggtctcgaggtgatcgaggcgcactggatcttcgggctgccgagcagccgcatcgac
gtgctgattcacccgcagagcgtgatccattcgctcgtctcgtacaaggacggctcggtg
ctcgcgcagctcggcaaccccgacatgcgcacgccgatcgcgcacgcgctcgcgttcccc
gagcgcgtcgacgccggcgtcgcgcagcttgacctggcgcagatcgccacgctcacgttc
gagcagcccgacctcgagcgcttcccgtgcctcgcgctggcgatccaggcgctcgacgcg
ggcggcgtggcgagcaccgtgctcaacgccgcgaacgagctggcggtggatgccttcctc
gaacgccggatcggcttcatggacatcgcgcgcacggtggacgcggtgctcaacagtctg
accaatcgcgaggccgccggcctcgacgacgtgctcgcggccgatgccgaggcgcgtcgc
gcggcagccgcggtgatcgctggcctgccagttccgcgcgcggagcgcgcagcctga

DBGET integrated database retrieval system