KEGG   Burkholderia glumae: bglu_1g13570Help
Entry
bglu_1g13570      CDS       T00905                                 

Definition
Arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bgl  Burkholderia glumae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    bglu_1g13570
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     bglu_1g13570
   3.1.2  Thioester hydrolases
    3.1.2.-  
     bglu_1g13570
Lipid biosynthesis proteins [BR:bgl01004]
 Fatty acid synthase
  Component type
   bglu_1g13570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1492494..1493552)
Genome map
AA seq 352 aa AA seqDB search
MPPRSSSGSITFSSAVRCGISWNDWNTKPTAPLRSAARSSSPRPVSSRPSRRTVPSVALS
KPASRPSSVDLPEPDAPTIATLLPAGTARSMPSRIVSSPAASATRFETCRTSMIGSVILM
SMKHIRSWKHGACAMMIATAATAWLGAPPAGAAAGAPAASPAGRAAKPAIVVLGDSLSAE
YGLPRDTGWVALMRARIADQRIDYSVANASVSGDTTSGGRARLPALLARLKPAIVIVELG
ANDALRGVPLATTEQNLRAIVAEARQANAKVVLIGMYVPPNYGLDYTQKFHAMYGKLAKE
LHLPLVPFLLAGIENRPELFQDDQNHPTQQAQPKLLDNVWPVVRPLLGAGAH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccgcgcagctcgagcggcagcatcacgttctcgagcgccgtcaggtgcggcatc
agctggaacgactggaacacgaaaccgaccgcgccgctgcgcagcgccgcgcgctcgtcc
tcgccgaggccggtcagttcgcggccgagcaggcgaaccgtgccgtccgtcgcgctgtcc
aagccggcgagcaggccgagcagcgtcgacttgcccgagcccgacgcgccgacgatcgcg
acgctgctgcccgccggcacggccaggtcgatgccgtcgagaatcgtcagctcgccggcc
gcgtcggcgacgcgcttcgagacctgtcgaacttcaatgatcggatccgtcatcttgatg
agcatgaagcacattcgttcctggaaacacggcgcatgcgccatgatgatcgcaacggcc
gccacggcctggcttggcgcgccgcccgctggcgcggccgccggcgcgccagcggcgagc
cccgcgggcagggccgccaagccggccatcgtggtgctcggcgacagcctctcggccgaa
tacggcctgcctcgcgacaccggctgggtcgcgctgatgcgggcacgcatcgccgaccag
cgaatcgattatagcgttgcgaacgcaagcgtcagcggcgacaccacgagcggcggtcgc
gcccgcctgcccgcgctgctcgcgcggctcaagcccgcgatcgtgatcgtcgagctcggc
gcgaacgacgcgctgcgcggcgtgccgctcgccaccaccgagcagaacctgcgcgcgatc
gtggccgaggcgcgccaggcgaacgcgaaggtcgtgctgatcggcatgtacgtgccgccg
aactacggcctcgactacacgcagaaattccacgcgatgtacggcaagctcgccaaggaa
ctgcacctgccgctcgtgccgttcctgctggccggcatcgagaaccgcccggagctgttc
caggacgaccagaaccatccgacgcagcaggcgcagccgaagctgctcgacaacgtctgg
ccggtggtgcggccgctgctcggtgccggcgcgcactga

DBGET integrated database retrieval system