KEGG   Burkholderia glumae: bglu_1g13720Help
Entry
bglu_1g13720      CDS       T00905                                 

Definition
Nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bgl  Burkholderia glumae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    bglu_1g13720
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     bglu_1g13720
    3.5.1.-  
     bglu_1g13720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1514247..1514873
Genome map
AA seq 208 aa AA seqDB search
MMRTDDVLLVIDVQNDFMPGGALAVADGDAVVPVINRLARRFDQVVITQDWHPRAHVSFA
ANHAGREPFSTLTLPYGEQVLWPVHCVQDTDGAALHRDLDVPHARLVIRKGLDPAVDSYS
AFVEADRATSTGLAAYLQALGAKRVWCCGLATDYCVAWSALDARAAGFEAAVIEDACRAI
DLDGSLARAWQDLHGAGVARVHADAVPL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggaccgacgacgtgctgctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtggccgacggcgacgcggtggtgccggtgatcaaccggctcgcgcgg
cgcttcgatcaggtggtgatcacgcaggactggcatccgcgcgcgcacgtgtcgtttgcc
gccaaccacgcgggccgcgagccgttctcgacgctgacgctgccctacggcgagcaggtg
ctgtggcccgtgcattgcgtgcaggacaccgacggcgccgcgctgcaccgcgatctcgac
gtcccccatgcgcggctcgtgatccgcaaggggctcgacccggccgtcgacagctattcg
gccttcgtcgaggccgaccgtgcgacttccaccggcctcgccgcctatctgcaggcgctc
ggcgccaagcgcgtctggtgctgcgggctcgccaccgactattgcgtcgcgtggtccgcg
ctcgatgcacgcgcggccggcttcgaggccgcggtgatcgaggacgcgtgccgcgcgatc
gacctcgacggctcgctcgcgcgcgcctggcaggaccttcacggcgcgggcgtggcccgc
gtgcatgcggacgcggtgccgctctga

DBGET integrated database retrieval system