KEGG   Burkholderia glumae: bglu_1g13720Help
Entry
bglu_1g13720      CDS       T00905                                 

Definition
Nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bgl  Burkholderia glumae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bgl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1514247..1514873
Genome map
AA seq 208 aa AA seqDB search
MMRTDDVLLVIDVQNDFMPGGALAVADGDAVVPVINRLARRFDQVVITQDWHPRAHVSFA
ANHAGREPFSTLTLPYGEQVLWPVHCVQDTDGAALHRDLDVPHARLVIRKGLDPAVDSYS
AFVEADRATSTGLAAYLQALGAKRVWCCGLATDYCVAWSALDARAAGFEAAVIEDACRAI
DLDGSLARAWQDLHGAGVARVHADAVPL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggaccgacgacgtgctgctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtggccgacggcgacgcggtggtgccggtgatcaaccggctcgcgcgg
cgcttcgatcaggtggtgatcacgcaggactggcatccgcgcgcgcacgtgtcgtttgcc
gccaaccacgcgggccgcgagccgttctcgacgctgacgctgccctacggcgagcaggtg
ctgtggcccgtgcattgcgtgcaggacaccgacggcgccgcgctgcaccgcgatctcgac
gtcccccatgcgcggctcgtgatccgcaaggggctcgacccggccgtcgacagctattcg
gccttcgtcgaggccgaccgtgcgacttccaccggcctcgccgcctatctgcaggcgctc
ggcgccaagcgcgtctggtgctgcgggctcgccaccgactattgcgtcgcgtggtccgcg
ctcgatgcacgcgcggccggcttcgaggccgcggtgatcgaggacgcgtgccgcgcgatc
gacctcgacggctcgctcgcgcgcgcctggcaggaccttcacggcgcgggcgtggcccgc
gtgcatgcggacgcggtgccgctctga

DBGET integrated database retrieval system