KEGG   Burkholderia glumae BGR1: bglu_1g13730Help
Entry
bglu_1g13730      CDS       T00905                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00071  Fatty acid degradation
bgl00072  Synthesis and degradation of ketone bodies
bgl00280  Valine, leucine and isoleucine degradation
bgl00310  Lysine degradation
bgl00362  Benzoate degradation
bgl00380  Tryptophan metabolism
bgl00620  Pyruvate metabolism
bgl00630  Glyoxylate and dicarboxylate metabolism
bgl00640  Propanoate metabolism
bgl00650  Butanoate metabolism
bgl00900  Terpenoid backbone biosynthesis
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
bgl01212  Fatty acid metabolism
bgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_1g13730
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_1g13730
   00640 Propanoate metabolism
    bglu_1g13730
   00650 Butanoate metabolism
    bglu_1g13730
  Lipid metabolism
   00071 Fatty acid degradation
    bglu_1g13730
   00072 Synthesis and degradation of ketone bodies
    bglu_1g13730
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bglu_1g13730
   00310 Lysine degradation
    bglu_1g13730
   00380 Tryptophan metabolism
    bglu_1g13730
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bglu_1g13730
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bglu_1g13730
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bglu_1g13730
Enzymes [BR:bgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bglu_1g13730
Exosome [BR:bgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bglu_1g13730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACR28522
UniProt: C5AFB5
Position
1:1514929..1516107
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTALAKSWRGALNMTHGATLGGHVVAAAVARAKLDPARVEDVLMGCANPE
GATGANIARQIALRAGLPVSVPGMTINRFCSSGLQTIALAAQRVIAGEGEVFVAGGVESI
SCVQNEMNHHMLQEGWLREHKPEIYWSMLQTAENVAKRYGIDRQRQDEYGVQSQQRAAAA
QAAGRFDDEIVPITVLAGVADKASGRLSTRELTLAADEGIRPDTTLEGVSKIRSALPGGV
ITAGNASQFSDGASACVVMSAKLAEREGLQPLGIFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLTVADIDLWELNEAFAVQVLYCRDTLGIPNERLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKRVVVTMCIGGGQGAAGLFEIA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatccaccgcccgcaccgcgcttgccaaatcgtggcgcggc
gcgctcaacatgacgcatggcgcgacgctcggcggccacgtggtcgccgcggccgtggcg
cgcgcgaagctcgacccggcgcgcgtcgaggacgtgctgatgggctgcgcgaatcccgaa
ggcgcgacgggcgccaacatcgcgcgccagatcgcgctgcgcgccggcctgccggtatcg
gtgccgggcatgacgatcaaccgcttctgctcgtcggggctgcagaccatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgaggtgttcgtggcgggcggggtggagtcgatc
tcgtgcgtgcagaacgagatgaaccaccatatgctgcaggagggctggctcagggagcac
aagccggagatctactggagcatgctgcagaccgccgagaacgtcgcgaagcgctacggc
atcgacaggcagcgccaggacgagtacggcgtgcaatcgcagcagcgcgcggccgccgcg
caggcggccggccggttcgacgacgagatcgtgccgatcacggtgctggccggcgtggcc
gacaaggcgagcgggcggctctcgacgcgcgagctcacgctcgcggccgacgaggggatt
cgccccgacaccacgctcgagggcgtctcgaagatccgttcggcgctgccgggcggcgtg
atcacggccggcaacgcgagccagttctccgacggcgcctcggcctgcgtggtgatgagc
gcgaagctggccgagcgcgaggggctgcagccgctcggcatcttccgcggcttcgcggtg
gccggctgcgagcccgacgagatgggcatcggcccggtgttcgcggtgccgaagctgctg
aagcaggccggcctgacggtggccgacatcgacctgtgggagctgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcggcatcccgaacgagcggctcaacgtgaac
ggcggcgcgatcgcggtcggccatccctacggcgtgtcgggcgcgcggctcaccggccat
gcgctgatcgaaggcaagcggcgcggcgcgaagcgcgtggtggtgacgatgtgcatcggc
ggcggccagggcgcggcggggctgttcgagatcgcctga

DBGET integrated database retrieval system