KEGG   Burkholderia glumae BGR1: bglu_1g14160Help
Entry
bglu_1g14160      CDS       T00905                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bglu_1g14160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_1g14160
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bglu_1g14160
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     bglu_1g14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1558816..1560267
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGEHHTFSDILLGGLAKDGGLYLPAEYPRVSAAELARWRALPYADLAFEV
LSKFSDDIPADELRALTRRTYRAEVYANTRHGENAADITPIKPLGTEGGAPISLLELSNG
PTLAFKDMAMQLLGNLFEATLAKHGETLNILGATSGDTGSAAEYAMRGKVGVRVFMLSPH
GKMSAFQRAQMYSLQDPNIFNLAVEGVFDDAQDIVKAVSNDHAFKARHKIGTVNSINWAR
VVAQVVYYFKGYFAATTSNEQRVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGRYRVRGAAQTYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSTHEDRLATIRDVYQRYATMIDTHTADGVKVAREHLQP
GVPMVVLETAQPIKFGETIREALGREAERPAGFEGIEALPQRFEVVQADVQQVKDFIVAH
TGG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatttcgacgcgcggcgccggcatcggcgagcaccatacgttttctgacatc
ctgctcggcggcctggcgaaggacggcgggctctacctgcccgccgagtacccgcgcgtg
agcgcggctgagctcgcacgctggcgcgcgctgccgtatgccgacctcgctttcgaggtg
ctctcgaagttcagcgacgacatccccgccgacgagctgcgcgcgctcacgcgccgtacc
taccgcgccgaggtctacgccaacacgcggcatggcgagaacgcggccgacatcacgccg
atcaagccgctcggtaccgagggcggcgcgccgatctcgctgctcgaactgtccaacggg
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgaggccacg
ctcgccaagcacggcgagacgctgaacatcctcggcgcgacttcgggcgacaccggcagc
gcggccgagtatgcgatgcgcggcaaggtcggcgtgcgcgtgttcatgctctcgccgcac
ggcaagatgagcgcgttccagcgcgcgcagatgtacagcctgcaggacccgaacatcttc
aacctcgccgtcgagggcgtgttcgacgacgcgcaggacatcgtcaaggcggtctcgaac
gaccacgccttcaaggcgcggcacaagatcggcacggtcaactcgatcaactgggcccgc
gtggtcgcgcaggtcgtctactacttcaagggctacttcgcggccaccacgagcaacgag
cagcgcgtctcgtttacggtgccgtcgggcaacttcggcaacgtctgcgccggccacatc
gcgcgcatgatgggcctgccgatcgagaagctggtggtggcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggccgctaccgcgtgcgcggcgccgcgcagacctatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgacccggcacgcgtgctgcagctgtttcgcgacgtcgaggagaagggc
ggcttcgatctggcggcgagcggcgacttcgcgcgcgtggccgagttcggcttcgtgtcg
gggcgcagcacgcacgaggaccgtctcgcgaccatccgcgacgtctaccagcgctacgcg
acgatgatcgacacgcacacggccgacggcgtgaaggtcgcgcgcgaacacctgcagccg
ggcgtgccgatggtcgtgctggagacggcgcagccgatcaagttcggcgagacgattcgc
gaggcgctcggccgcgaggcggagcgcccggcagggttcgagggcatcgaggcgctgccg
cagcgcttcgaggtcgtgcaggccgacgtgcagcaggtgaaggacttcatcgtcgcgcat
acgggcggctga

DBGET integrated database retrieval system