KEGG   Burkholderia glumae: bglu_1g14370Help
Entry
bglu_1g14370      CDS       T00905                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bgl  Burkholderia glumae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bglu_1g14370
DNA repair and recombination proteins [BR:bgl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      bglu_1g14370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1582759..1583355
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAERLGQSLLFATQHLQHCEKC
NTFTEAQICEVCSDTERDPSLLCVVETPADQIMLEQTLTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLSVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccgtccgccctgtccgccctcgtcgaagcactgcgcgtgctgcccggcgtg
ggtccgaaatccgcgcagcggatggcctaccacctgatgcagcacgatcgggagggcgcc
gagcggctcgggcagtcgctgctgttcgccacccagcatctgcagcattgcgagaagtgc
aacaccttcaccgaggcgcagatctgcgaggtctgcagcgacaccgagcgtgatccgagc
ctgctgtgcgtggtcgagacgccggccgaccagatcatgttggagcagacgctgacttac
cgcgggctctatttcgtgctgatggggcggctgagtccgctcgacggcatcggcccgaag
gaaatccatttcgaccggctcgtgcggcgtgcctcggacggcatcgtgaaggaggtcgtg
cttgcgaccaacttcaccaacgagggcgaggcgaccgcccattatctcggccagacgctg
aaggcgcgcggcctgtcggtcacgcggctcgcgcgcggcgtaccggtgggcggtgagctc
gaatacgtcgacgcgggcaccatcgcgcgcgcgatgctcgaccgccgcacgatgtga

DBGET integrated database retrieval system