KEGG   Burkholderia glumae: bglu_1g14400Help
Entry
bglu_1g14400      CDS       T00905                                 

Definition
Protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bgl  Burkholderia glumae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1585436..1586302
Genome map
AA seq 288 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKAAARTTERHPTSPARPTLGASVAGSPARPAGLARAAAH
GPAGAAGPAGKPALALTSERVRERMVERLRANGVTDTRVLGAIAAVPRHLFVDPGLAAQA
YEDAALPIGHQQTISKPSVVARMIELALAGRSPERVLEIGTGCGYQAAVLSHLARDVYSI
ERVKPLFERAKRNLRPLRVPNIRLHYGDGRLGLPSAAPFDAIVIAAAGLDVPQALVEQLA
VGGRLVAPVGAQSGDSQVLTLVERVGPTQWRESRLDRVFFVPLKSGVI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgccaagcggttcccgcttgcgctcgaggatctcaaacgcgcgccg
cgcaaggccgccgcccgcaccaccgagcgccatccgacttcgcccgcgcggccgacgctc
ggcgcctcggtcgcgggctcgccggcgcggccggccgggctcgcgcgcgcggccgcgcac
ggccccgccggcgccgcgggtccggcgggcaaacccgcgctcgcgctgacgtcggaacgg
gtccgcgagcgcatggtcgaacgtctgcgcgccaatggggtgaccgatacgcgcgtgctc
ggcgcgatagcggccgtgccgcgccacctgttcgtggatccgggcctcgccgcccaggcc
tacgaggacgcggcgctgccgatcggccatcagcagaccatttcgaaaccgtcggtggtg
gcccgcatgatcgagctcgcgctggcgggccgctcgcccgagcgcgtgctcgagatcggc
accggctgtggctatcaggcggccgtgctgagccatctcgcgcgggatgtttattcgatc
gagcgtgtcaagccattgttcgagcgcgcgaaacgcaacctccggccgttgcgcgttccg
aacatccggctgcattacggcgacggccgcctcggcctgccgtcggccgcgccgttcgat
gcgatcgtgatcgccgcggcggggctcgacgtgccgcaggcgcttgtcgaacaactggcc
gtgggcgggcggctcgtcgcgccggtaggcgcgcagagcggcgactcgcaggtgctgacg
ctcgtcgagcgggtcgggccgacgcaatggcgggagtcccggcttgatcgcgttttcttt
gtccccttaaaatccggagtgatttga

DBGET integrated database retrieval system