KEGG   Burkholderia glumae: bglu_1g17680Help
Entry
bglu_1g17680      CDS       T00905                                 

Definition
glycoside hydrolase, family 42-like protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bgl  Burkholderia glumae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bglu_1g17680
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     bglu_1g17680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1940576..1942579
Genome map
AA seq 667 aa AA seqDB search
MRLGVCYYPEHWPEAMWNDDAARMKALGIEQVRIAEFAWSRIEPQPGEYDWGWLDRAIEV
LGAAGLQVVMCTPTATPPKWLVDRHPEILPVGADGRPRAFGSRRHYDFSSPSYFEASQRI
CEAVARRYGAHPAVAYWQTDNEYGCHQTVVSYSPAAQARFRDWLRARYGTIEALNAAWGT
VFWSMEYRSFDEIDAPVGTVTEAHPSHRLDYRRFASDEVRRYNRMQVEILRAHSPGRPIA
HNFMQLFTEFDHYPVAADLDVAGWDSYPLGALEEQWYAPEVKARYLRTGHPDFASFNHDL
YRGMSRLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDLGGSEAAQVAGELRALLADAEAGATAPVRASVALLFDYTAKWLFE
VHPQGADFHYPRFVVEYYSALRSLGFDVDVVAPDAPLDGYRLVVVPPLPIVSEALAQRLA
SCGAQVVLGPRTGSKTPDLQIPANLPPGPLAAHLPIRVWRVESLRPTLAETVQVAAAPDA
AAFETPARHWRDLVEIDPAQAASVEIRARFHDGHPAYLRHGVFHYFASLFDEAGTATLLA
RVAREAGLAPVPLGDAVRVSRRGGLTWVFNYGPEPYRIDAAIPDAAIVVGARCIEAAGVA
AYRTAAG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttggagtctgttactaccccgaacactggccggaagccatgtggaacgacgat
gccgcgcgcatgaaggcgctcggcatcgagcaggtgcggatcgccgaattcgcctggagc
cggatcgagccgcagccgggcgaatacgactggggctggctcgaccgcgcgatcgaggtg
ctcggcgcggccggcctgcaggtcgtgatgtgcacgcccaccgcgacgccgccgaagtgg
ctggtcgaccggcatcccgagatcctgccggtcggcgccgacggccggcctcgcgcgttc
ggctcgcgccgtcattacgatttctcgtcgccgagctacttcgaggcgtcgcagcgcatc
tgcgaggccgtggcgcgccgctacggcgcccatccggccgtggcctactggcagaccgac
aacgaatatggctgccaccagaccgtggtcagctactcgccggccgcgcaggcacgcttt
cgcgactggctgcgcgcgcgctacggcaccatcgaggcgctcaacgcggcctggggcacg
gtgttctggagcatggaataccgcagcttcgacgagatcgacgcgccggtcggcacggtc
accgaggcgcacccgtcgcatcggctcgactatcgccgcttcgcctccgacgaggtgcgg
cgctacaaccggatgcaggtcgagatcctccgcgcgcattcgccgggccggccgatcgcg
cacaacttcatgcagctgttcaccgagttcgaccattatccggtggcggccgacctcgac
gtggcgggctgggacagctatccgctcggcgcgctcgaggagcagtggtacgcgcccgag
gtgaaggcgcgctacctgcgcaccgggcaccccgatttcgcgtcgttcaaccacgacctc
taccgcggcatgtcgcggctgccgttctgggtgatggagcagcagccggggccggtgaac
tgggcgcactggaacccggcgccgctgccgggcatggtgcggctctggagctgggaggcg
ttcgcccacggcgccggctgcgtctcgtacttccgctggcgccaggccccgttcgcgcag
gagcagatgcacgcggggctgaacacgcccgacaaccggctcgacctcggcggcagcgag
gccgcccaggtggccggcgagttgcgcgcgctgctcgccgacgccgaggccggggccacc
gcgccggtgcgcgccagcgtggcactgctgttcgactacaccgcgaaatggctgttcgag
gtgcatccgcaaggcgccgatttccactatccccgcttcgtcgtggagtactactcggcg
ctgcgctcgctcggcttcgacgtggacgtggtggccccggacgcgccgctcgacggctac
cggctggtggtggtgccgccgctgccgatcgtctccgaggcgctggcgcagcggctcgcc
agctgcggcgcgcaggtcgtgctcggcccgcgcaccggctcgaagacgcccgatctgcag
attcccgcgaacctgccgcccggcccgctcgcggcgcatctgccgatccgcgtctggcgc
gtggagtcgctgcggccgacgctcgccgagaccgtgcaggttgccgccgcgcccgacgcc
gcggccttcgagacgccggcgcgccactggcgcgatctcgtcgagatcgacccggcccag
gcggcgtcggtcgagatccgcgcacgctttcacgacggtcatccggcctatctgcgccac
ggcgtgttccattatttcgcgagcctgttcgacgaggccggcacggcgacgctgctggcg
cgcgtcgcgcgcgaggcgggcctcgcgcccgtgccgctcggcgacgcggtgcgcgtgagc
cggcgcggcgggctgacctgggtgttcaactacggccccgagccctaccggatcgacgcg
gcgatccccgatgcggcgatcgtggtcggcgcgcgctgcatcgaggccgccggtgtcgcc
gcctatcgcaccgcggccggctga

DBGET integrated database retrieval system