KEGG   Burkholderia glumae BGR1: bglu_1g19930Help
Entry
bglu_1g19930      CDS       T00905                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00020  Citrate cycle (TCA cycle)
bgl00310  Lysine degradation
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Module
bgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bglu_1g19930
  Amino acid metabolism
   00310 Lysine degradation
    bglu_1g19930
Enzymes [BR:bgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     bglu_1g19930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACR29102
UniProt: C5AGZ5
Position
1:complement(2179096..2180367)
Genome map
AA seq 423 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV
LQNDGDTVLADQVIATIDTEAKAGAVAAAAGKAEVQPAAAPVAVAPAAQPAAAAGSSHAA
SPAAAKLLAEKGVDASQVAGTGRDGRITKGDALAANAAPAKAAAAPAAAAPKKAALPDVK
VPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKD
KFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVP
ILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQ
SAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLL
LDL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagtcccccagctttccgaatcggtatcggaagcgaccatg
ctgcagtggaagaagaagcccggtgaggccgtcgcgcaggacgaaatcctgatcgaactc
gaaaccgacaaggtcgtgctcgaagtgccggcgccggccgccggcgtgctgtcgcaagtg
ctgcagaacgacggcgacaccgtcctggccgatcaggtgatcgccaccatcgacaccgaa
gcgaaggcgggtgccgtcgccgcggccgccggcaaggccgaagtgcaaccggccgcagcg
cccgtcgccgtggcgccggccgctcagccggccgctgcagccggctcgagccacgccgcc
tcgccggccgccgcgaagctgctggccgagaagggcgtggacgcgagccaggtcgccggc
acgggccgcgacggccgcattaccaagggcgacgcgctggccgcgaacgccgcgccggcc
aaggccgctgccgcaccggccgccgccgcgccgaagaaggccgcgctgccggacgtgaag
gtgccggcctcggccaccacctggctgaacgaccgtccggagcagcgcgtgccgatgtcg
cgcctgcgcgcgcggatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatcctg
acgacgttcaacgaagtgaacatgcagcccgtcatggacctgcgcgcgaagtacaaggac
aagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtcaaggcggcg
gtccacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtc
taccacggctatttcgacatcggcatcgcggtcggttcgccgcgcggcctggtggtgccg
atcctgcgcaacgccgaccaattgagcctcgccgacatcgagaagaagatcgccgaattc
ggccagaaggccaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttctcg
atctcgaacggcggcgtgttcggctcgatgctctcgaccccgatcatcaacccgccgcag
tcggcgatcctcggcgttcacgcgaccaaggagcgtccggtggtcgagaacggccagatc
gtgatccgcccgatcaactacctcgcgctgtcctatgaccaccggatcatcgacggtcgc
gaagcggtgctgtcgctggtggcgatgaaggatgcgctggaagatccggcgcgcctgctg
ctcgacctgtaa

DBGET integrated database retrieval system