KEGG   Burkholderia glumae: bglu_1g21910Help
Entry
bglu_1g21910      CDS       T00905                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgl  Burkholderia glumae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bglu_1g21910
   00052 Galactose metabolism
    bglu_1g21910
   00500 Starch and sucrose metabolism
    bglu_1g21910
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_1g21910
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bglu_1g21910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2385187..2386068
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPANVDFFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLDGQPPVMKQMVDVFDHYHSSIIGVEEIPPADTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFHHLRTIQPGAGGEIQLTDGIQALLA
DEQVLAYKYEGTRFDCGSKLGYLKATIEFALRHPEVRDEFEQYLRERGTGSPA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcactaaggcggtatttccggttgccggcctcggcacccgctttctgccg
gcgacgaaggcaagcccgaaagagatgctgcccgtcgtcgacaagcccttgatccagtac
gccgtcgaggaagccatcgcggccggcatcacggaaatgatcttcgtcaccggccgcagc
aagcgcgcgatcgaggatcacttcgacaagtcctacgagatcgaagccgagctcgaggca
cgcggcaaggaaaagctgctcgatctggtgcgcagcatcaagcccgccaacgtcgacttc
ttctacgtgcgccagcccgaggcgctcggcctcggccacgccgtgctctgcgccgagaag
ctggtgggcgacaacccgttcgccgtgatcctcgccgacgacctgctcgacggccagccg
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcgatcatcggcgtg
gaggaaatcccgccggccgacaccaagtcctacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaagccggcgcccgaagtggcgccgtcg
aacctcggcgtggtgggccgctacatcctgaagccgcgcatcttccatcacctgcgcacg
atccagcccggcgcgggcggcgagatccagctgaccgacggcatccaggccctgctggcc
gacgagcaggtgctcgcctacaagtacgaaggcacccgcttcgactgcggcagcaagctc
ggctacctgaaggccaccatcgaattcgcgctgcgccacccggaggtgcgcgacgagttc
gagcagtacctgcgcgagcgcggcaccggctcgccggcctga

DBGET integrated database retrieval system