KEGG   Burkholderia glumae BGR1: bglu_1g21910Help
Entry
bglu_1g21910      CDS       T00905                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00040  Pentose and glucuronate interconversions
bgl00052  Galactose metabolism
bgl00500  Starch and sucrose metabolism
bgl00520  Amino sugar and nucleotide sugar metabolism
bgl01100  Metabolic pathways
bgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bglu_1g21910
   00052 Galactose metabolism
    bglu_1g21910
   00500 Starch and sucrose metabolism
    bglu_1g21910
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_1g21910
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bglu_1g21910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACR29294
UniProt: C5A8E6
Position
1:2385187..2386068
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPANVDFFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLDGQPPVMKQMVDVFDHYHSSIIGVEEIPPADTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFHHLRTIQPGAGGEIQLTDGIQALLA
DEQVLAYKYEGTRFDCGSKLGYLKATIEFALRHPEVRDEFEQYLRERGTGSPA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcactaaggcggtatttccggttgccggcctcggcacccgctttctgccg
gcgacgaaggcaagcccgaaagagatgctgcccgtcgtcgacaagcccttgatccagtac
gccgtcgaggaagccatcgcggccggcatcacggaaatgatcttcgtcaccggccgcagc
aagcgcgcgatcgaggatcacttcgacaagtcctacgagatcgaagccgagctcgaggca
cgcggcaaggaaaagctgctcgatctggtgcgcagcatcaagcccgccaacgtcgacttc
ttctacgtgcgccagcccgaggcgctcggcctcggccacgccgtgctctgcgccgagaag
ctggtgggcgacaacccgttcgccgtgatcctcgccgacgacctgctcgacggccagccg
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcgatcatcggcgtg
gaggaaatcccgccggccgacaccaagtcctacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaagccggcgcccgaagtggcgccgtcg
aacctcggcgtggtgggccgctacatcctgaagccgcgcatcttccatcacctgcgcacg
atccagcccggcgcgggcggcgagatccagctgaccgacggcatccaggccctgctggcc
gacgagcaggtgctcgcctacaagtacgaaggcacccgcttcgactgcggcagcaagctc
ggctacctgaaggccaccatcgaattcgcgctgcgccacccggaggtgcgcgacgagttc
gagcagtacctgcgcgagcgcggcaccggctcgccggcctga

DBGET integrated database retrieval system