KEGG   Burkholderia glumae: bglu_1g22170Help
Entry
bglu_1g22170      CDS       T00905                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bgl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bgl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2415992..2417062
Genome map
AA seq 356 aa AA seqDB search
MSAIPSTPAFGPAGQRVSSRPWGRLPGGDPVRLFTLRNAHGMRVAISDLGATLVSWQTPD
RGGRLGEILLGFDAPAAYLDSRAYLGALVGRCSNRIAGARFTLDGIDYPLDRNDGEQCLH
GGLSGFHRALWEADMLDDALLMRLVSPEGDGGFPGNVEVQVRYALDDDGTLSIGYEARAD
APTPLQLTSHPYFNLSGRPRADIDGHVLTIDADRYLEVDARMIPTRLASVAGTAFDFRQS
APLGARLGWPHAQLALAGGFDHCFALREAEGDGGVRAVARVYDPGSGRELTVLTDQPGLQ
LYTGNSLAGLHGPRSALCLEAGAFPNQINSEDAEAVVLRPGEVYRQDTRYRVAVAG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcaatcccatcgacgccggccttcgggccggccggtcagcgtgtctcgtcgcgg
ccgtggggccgcctgcccggcggcgacccggtgcgcctcttcacgctgcgcaacgcccac
ggcatgcgggtggcgatcagcgacctcggcgcgacgctggtgtcgtggcagacgcccgac
cgcggcggccggctcggcgagatcctgctcggcttcgacgcgccggccgcctacctcgat
tcgcgcgcctatctcggcgcgctggtggggcgctgctcgaaccgcatcgcgggcgcgcgc
ttcacgctcgacggcatcgactacccgctcgaccgcaacgacggcgagcagtgcctgcac
ggcggcctgagcggctttcaccgcgcgctgtgggaggccgacatgctcgacgacgcgctg
ctgatgcggctcgtctcgcccgagggcgacggcgggttccccggcaacgtcgaggtgcag
gtgcgctatgcgctcgatgacgacggcacgctgtcgatcggctatgaggcgcgcgccgac
gcgcccacgccgctgcagctgacgagccatccgtatttcaacctgagcgggcgcccgcgt
gccgacatcgacgggcacgtcctgacgatcgacgccgaccgctatctggaagtggacgcg
cggatgatcccgacgcggctcgcgagcgtggccggcaccgcgttcgatttccgccagagc
gcgccgctcggcgcgcggctcggctggccgcatgcgcagctcgcgctggcgggcggcttc
gaccactgcttcgcgctgcgcgaggccgaaggcgacggcggcgtgcgcgccgtggcgcgc
gtctacgatcccggcagcggccgcgagctaacggtgctgaccgaccagccgggcctgcag
ctttatacgggcaattcgctggcgggcctgcacgggccgcgcagcgcgctgtgcctggaa
gcgggtgcgttcccgaaccagatcaattcggaagacgccgaggcggtggtgctgcgcccc
ggcgaggtgtatcggcaggacacgcggtatcgggtggcggtggcgggataa

DBGET integrated database retrieval system