KEGG   Burkholderia glumae: bglu_1g22270Help
Entry
bglu_1g22270      CDS       T00905                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     bglu_1g22270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2427284..2428714)
Genome map
AA seq 476 aa AA seqDB search
MRSQHEDFARPRPVRHARAARAAAIVVLVSAGALAGCDSRAPGASGGAPAAAAAGAVRPA
AQPAAAAPAGASAPLVVRNQPQTRAQVFEAVRKMTALGKQMFFDPSLSGSGKLACASCHS
PQHAFTPANALSVQLGGDDLRQQGFRAVPTLMYLQKVPPFTEHFHDSDEEGDESVDAGPT
GGLTWDGRVDHGEEQARMPLTTPFEMNSTPAKVARAVRAAPYSADFRAAFGEQVFGSDEA
TFQAVLQALGAFEQSPEVFTPYSSKYDAFLDHKAKLTEAEMRGLLLFNDERKGNCASCHI
SQRALDGSPPQFSDFGLIAIGVPRNRALAVNRDPKFFDLGACGPQRQDLKGRDEYCGIFR
TPTLRNVALKQSFFHNGIYHSLEDVLRFYAQRDTNPEKFYPVRHGVVQKFDDLPRRYWAN
LNTEPPFDRKKGDKPALDEAEIQDVIAFLHTLTDGYQPTRITSSAELGAAPGAAPH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagccagcacgaagacttcgcccggccccggccggttcgccatgcccgggccgcg
cgcgcggccgcgatcgtcgtgctggtgtcggccggcgcgctggcgggctgcgactcgcgt
gcgccgggcgcgtcgggcggggcgccggctgcggctgcggccggggcggtgcggccggct
gcccagccggcggctgccgcgccggcgggtgcgagcgcgccgctcgtggtcaggaaccag
ccgcagacgcgcgcgcaggtattcgaggccgtcagaaaaatgacagcgctgggtaagcag
atgtttttcgatccatcgctgtccggctccggcaagcttgcctgcgcctcgtgccatagc
ccacagcacgcgttcacgccggccaacgcgctatcggtgcagctgggcggcgacgatctg
cgccagcagggctttcgtgcagtgccgacgctgatgtatctgcagaaggtgccgcccttc
accgagcatttccacgactcggacgaggagggcgacgagagcgtggacgccggcccgacg
ggcggcctgacctgggacgggcgcgtcgatcacggcgaggagcaggcgcggatgccgctc
accacgccgttcgagatgaacagcacgccggccaaggtggcccgcgcggtgcgcgcggcg
ccgtattcggccgatttccgcgcggccttcggcgaacaggtgttcggcagcgacgaggcc
accttccaggcggtgctgcaggcgctcggcgcgttcgagcagtcgccggaagtcttcacg
ccttattcgagcaagtacgacgcgttcctcgaccacaaggccaagctcaccgaggccgag
atgcgcggcctgctgctgttcaacgacgagcgcaagggcaactgcgcgagctgccacatc
agccagcgcgcgctcgacggctcgccgccgcagttcagcgacttcggcctgatcgcgatc
ggcgtgccgcgcaaccgcgcgctggccgtgaaccgcgatccgaagttcttcgacctcggc
gcctgcgggccgcagcgccaggacctgaagggccgcgacgaatactgcgggatcttccgc
acgccgacgctgcgcaacgtcgcgctgaagcagtcgttcttccacaacggcatctatcac
tcgctcgaggacgtgctgcgcttctacgcgcagcgtgacacgaatccggagaagttctac
ccggtgcgccacggcgtggtgcagaaattcgacgacctgcccaggcgctactgggcgaac
ctcaataccgagccgccgttcgatcgcaagaagggcgacaagccggcgctcgacgaggcc
gagatccaggacgtgatcgcgttcctgcatacgctgacggacggctatcagcccacccgg
atcaccagcagcgccgagctcggtgccgcgccgggcgcggcgccgcactga

DBGET integrated database retrieval system