KEGG   Burkholderia glumae: bglu_1g23590Help
Entry
bglu_1g23590      CDS       T00905                                 

Definition
tRNA-Ile-lysidine synthetase
Orthology
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     bglu_1g23590
Transfer RNA biogenesis [BR:bgl03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    bglu_1g23590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2592116..2593555)
Genome map
AA seq 479 aa AA seqDB search
MISPHETAADRVVLDAVRGALDALPEAATIAIAYSGGLDSSVLLDAAVRVAGAARCVALH
VHHGLSPNADAWLAHAAACAAALGVCFDAQRVEVPRESGLGVEASARELRYRALDALGER
HGAQALWIAQHADDQAETVLLQLLRGAGLAGIAAMAPRYLPDGATIVRMRPLLSLLRAQL
ERYAEARALRWIDDESNADTRYARNALRARVLPELAVHFPGFRDALARTAQHAAAAQRLL
DVLAADDLAGATRDDGRVLSRERLLGFDDERGANLLRHWMRTLGLPGASAARLAEMIKQL
RAAQVSHALRIDHAGQCLRLYRDDVYWEAGDSADPADDDSAPERPLARLEWAGQEVWHLP
AWRGSFVFRPVDAAPAAAAGASDLVAEAVLAGAPLVARARAGGERMRMSPGGPSRTLKNL
FQERGVPAWQRDVPLLHVGETLLFVPRLGVNRAPEAGGAGAGVAGPCRRIEWRPDLLIA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatttctccgcatgagactgccgcggaccgcgtcgtgctcgacgcggtccgcggcgct
ttggacgcgctgcccgaggccgccacgatcgcgatcgcgtacagcggcgggctcgactcg
tcggtgctgctcgacgcggccgtgcgcgtggccggcgccgcgcgctgcgtggcgctgcat
gtccaccacgggctgagccccaacgccgatgcctggctcgcgcatgccgcggcgtgcgcg
gccgcgcttggcgtgtgcttcgatgcacaacgcgtcgaggtgccgcgcgagagcgggctc
ggcgtcgaggcgagcgcgcgcgagcttcgctatcgcgcgctcgacgcgctgggcgagcgc
cacggcgcgcaggcgctgtggatcgcgcaacacgccgacgaccaggccgaaacggtgctg
ctgcaattgctgcgcggcgcggggctggccggcatcgccgcgatggcgccgcgctacctg
cccgacggcgcgacgatcgtgcgcatgcgtccgctgctgtcgctgttgcgcgcgcagctc
gaacgctacgccgaggcgcgcgcgctgcgctggatcgacgacgagtcgaatgccgacacg
cgttatgcgcgcaatgcgctgcgtgcgcgagtcctgcccgaactcgccgtccactttccc
ggattccgtgacgcgctggcgcgtaccgcccaacatgcggccgccgcgcagcggctgctc
gacgtgctcgcggccgacgatctcgccggcgcgacgcgcgacgacggccgcgtgctctcg
cgcgagcgcctgctcggcttcgacgacgaacgcggcgcgaacctgctgcgccactggatg
cgcacgctcggcctgcccggcgcctcggccgcacggctcgccgagatgatcaagcagctg
cgcgccgcgcaggtctcgcatgccttgcgtatcgatcacgcagggcaatgcctgcggctc
tatcgcgacgacgtgtactgggaagctggcgacagcgctgatccggccgacgacgacagc
gcgcccgagcgtccgctcgcgcggctcgagtgggcggggcaggaggtctggcatctgccg
gcgtggcgcggcagcttcgtgttccggccggtcgacgcggcgccggccgcggcagccggc
gccagcgatctggtcgccgaggccgtgctggcgggcgcgccgctcgtggcgcgcgcacgg
gccggcggcgagcggatgcgaatgtcgccgggcgggccgtcgcgcaccctcaagaatctg
ttccaggagcgcggcgtgccggcgtggcagcgggacgttccgctgctgcatgtcggcgag
acgctgctgttcgtgccgcggctcggcgtcaatcgcgcgccggaggcgggcggggcgggc
gccggcgtggcgggtccgtgccggcgcatcgagtggcggcccgatctgctgattgcctga

DBGET integrated database retrieval system