KEGG   Burkholderia glumae: bglu_1g25960Help
Entry
bglu_1g25960      CDS       T00905                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bglu_1g25960
   01230 Biosynthesis of amino acids
    bglu_1g25960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g25960
   00051 Fructose and mannose metabolism
    bglu_1g25960
   00562 Inositol phosphate metabolism
    bglu_1g25960
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bglu_1g25960
Enzymes [BR:bgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bglu_1g25960
Exosome [BR:bgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bglu_1g25960
  Exosomal proteins of bladder cancer cells
   bglu_1g25960
  Exosomal proteins of melanoma cells
   bglu_1g25960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2958154..2958909)
Genome map
AA seq 251 aa AA seqDB search
MSTQRVKRVIGNWKMHGRLNGNRALLGEVLDGAQAVSADVEIGVCVPFPYLAQVGELLAG
SRVASGAQDVSAHEQGAYTGEVAGAMIAEFGAKYVLVGHSERRTYHGESSNLVAVKAQRA
LGAGLTPVVCVGETLAEREAGSTETVVGAQLDAALALLSDQEAARIVVAYEPVWAIGTGK
SASSEQAQQVHAFLRSRLAAKGVEQVSVLYGGSVKPDNARELFGQPDIDGGLIGGASLKG
GDFLAICRAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaacgagtgaagcgggtaatcggtaactggaagatgcacggccgtctcaac
ggcaatcgcgcgctgctgggcgaagtgctcgatggggcgcaggccgtgtcggccgacgtc
gagatcggcgtatgcgtgccgtttccgtatctggcgcaggtcggcgaattgcttgccggc
agccgtgtcgcgagcggcgctcaggacgtgtcggcgcacgagcaaggcgcgtacacgggc
gaggtggccggcgcgatgatcgccgagttcggcgcgaaatacgtgctggtcggccactcc
gagcgccgtacctatcacggcgaatcgagcaatctggtcgccgtgaaggcgcagcgcgcg
ctcggcgcggggctgaccccggtggtctgcgtcggcgagacgctggccgagcgcgaagcg
ggttcgaccgagacggtggtcggcgcgcagctcgatgcggcgctcgcgctgctgtcggac
caagaggcggcgcgcatcgtggttgcctacgagccggtctgggcaatcggcacgggcaag
agcgcaagttcggagcaggcacagcaggtgcatgccttcctgcgttcgcggcttgcggcc
aagggcgtcgagcaggtttccgtgctgtacggcggcagcgtgaagccggacaatgcgcgc
gaactgttcggtcagcccgacatcgacggcggcctgatcggtggcgcatcgttgaagggc
ggcgatttcctggcgatctgccgcgcggcgcagtaa

DBGET integrated database retrieval system