KEGG   Burkholderia glumae: bglu_1g30420Help
Entry
bglu_1g30420      CDS       T00905                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bgl  Burkholderia glumae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    bglu_1g30420
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     bglu_1g30420
Exosome [BR:bgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bglu_1g30420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3456345..3457847
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPRPGWVEHDPHEIWSTQAGVA
AEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGQPIYNAIVWQDRRTADFCDALKADGL
EAMVRAKTGLPIDSYFSGTKIRWILDNVEGAREKARQGRLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTRQWDDELLAALDIPRSMLPEVRASSEVYGHTKTTVFASKLPLAG
IAGDQQAALFGQMCTTKGMVKNTYGTGCFLVMNTGDTPIESSNNLVTTIAWQVGDQVNYA
LEGSIFIAGAVVQWLRDGLGIIKSAAEIEKLAASVPHTDGVYLVPAFAGLGAPHWNARAR
GSLFGVTRGTTDAHLARAALDAIAYQSLDVLAAMEADSGISIGELRVDGGASANNLLMQF
QADLLGVDVVRPRITETTALGAAYLAGLATGYWQNIDEVRSQWKLDRRFSPSLPSDEVSA
ALAGWQRAVRAAKAWADDAQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcaatacatcctcgcactcgaccagggcacgacgagctcacgcgcgatgctg
ttcgatcgccagggcaacatcgtatcgatcgcccagaaggagttcgaacaaatctatccg
cgcccgggctgggtcgagcacgacccgcacgagatctggtcgacgcaggccggcgtcgcc
gccgaggcggtcacgcgagtcggcctcaacggcaccgcgatcgccgcgatcgggatcacc
aaccagcgcgagacgaccatcgtctgggaccgcgagacgggccagccgatctacaacgcg
atcgtatggcaggaccgccgcaccgccgacttctgcgacgcgctgaaggccgacggcctg
gaagctatggtgcgcgcgaagaccggcctgccgatcgactcctacttctcgggcaccaag
atccgctggatcctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggccggctc
gcgttcggcaccgtcgacagctggctggtgtggaacttcaccaagcacgagctgcacgtg
accgacgtgaccaacgcgtcgcgcaccatgctgttcaacatccacacgcgccaatgggac
gacgagctgctggccgcgctcgacatcccgcgcagcatgctgcccgaggtgcgcgcctcg
tccgaggtctacggccacaccaagaccaccgtgttcgcctcgaaactgccgctggccggc
atcgcgggcgaccagcaggcggccctgttcggccagatgtgcaccaccaagggcatggtg
aagaacacctacggcaccggctgcttcctcgtgatgaacaccggcgacacgccgatcgag
tcgagcaacaacctcgtcacgaccatcgcctggcaggtgggcgaccaggtgaactacgcg
ctcgaaggcagcatcttcatcgccggcgcggtggtgcagtggctgcgcgacgggctcggc
atcatcaagtcggccgccgaaatcgagaagctcgcggcgagcgtgccgcacaccgacggc
gtctatctggtgccggccttcgccgggctcggcgcgccgcactggaacgcccgcgcgcgc
ggctcgctgttcggcgtcacgcgcggcaccaccgatgcgcacctggcgcgcgccgcgctc
gacgcgatcgcctaccagtcgctcgacgtgctcgcggcgatggaagccgattcgggcatc
agcatcggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctgatgcagttc
caggccgatctgctcggcgtggacgtggtgcgcccgcgcatcaccgaaaccaccgcgctc
ggcgccgcgtatctcgccgggctcgccaccggctactggcagaacatcgacgaggtgcgc
agccagtggaagctcgaccggcgcttctcgccgtcgctgccgtccgacgaggtgagcgcg
gcgctggccggctggcagcgcgcggtgcgcgccgccaaggcgtgggccgacgacgcgcag
taa

DBGET integrated database retrieval system