KEGG   Burkholderia glumae: bglu_1g31310Help
Entry
bglu_1g31310      CDS       T00905                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bgl  Burkholderia glumae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bgl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3559342..3560220
Genome map
AA seq 292 aa AA seqDB search
MTDTSRALRNCLAPAKLNLFLHITGRRPDGYHALQTVFQLLDWGDTLHYTRRDDGVVRRV
TEVAGVPEDGDLVVRAARLLQAHTGTALGVDIEIDKVLPMGAGLGGGSSDAATTLLALNR
LWELNLPRTELQALAVKLGADVPFFVFGKNAFAEGIGEALEQVELPTRWFLVVTPRVHVP
TAEIFSDKSLTRDSKPITITDFLAQQSSKGWPDSFGQNDMQAVVTKKYAEVAKAVEALYD
LTPARMTGSGASVFAAFSSRSEAEAAQAKLPAGWNSAVSGSLGTHPLFAFAF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacctcccgcgcgctgcgcaactgcctcgcccccgcgaagctcaacctgttc
ctgcacatcaccggccgccgcccagacggctatcacgcgctgcagaccgtgttccagctg
ctcgactggggcgacacgctgcattacacgcgacgcgacgacggcgtcgtgcgccgcgtc
accgaagtggcgggcgtccccgaggacggcgacctcgtggtgcgcgccgcgcggctgctg
caggcgcataccggcaccgcgctcggcgtcgacatcgagatcgacaaggtgctgccgatg
ggcgccggtctcggcggcggcagttcggacgcggccaccacgctgctcgcgctgaaccgc
ctctgggagctgaacctgccgcgcaccgaactgcaggcgctggcggtgaaactgggcgcc
gacgtgccgttcttcgtgttcggaaaaaatgcgtttgcggagggtatcggagaagcattg
gagcaggtagaattgccgactcgctggttcctggttgtgacgcctcgggttcacgtaccg
accgccgaaattttttcggataagtcgttgacaagagattcgaagccaatcacaattacg
gactttcttgcacagcaaagcagcaagggttggccagacagcttcggtcaaaacgacatg
caggcggttgtgacaaagaagtacgcggaagttgcaaaggcggtcgaagcattgtatgat
ttgacccccgcgcggatgaccggctctggagctagcgtgtttgcagcgttcagcagcagg
agcgaagcagaagcggcgcaagccaaactgccggccggctggaacagcgcagtttccgga
agcctgggtactcatcccctctttgctttcgcgttctaa

DBGET integrated database retrieval system