KEGG   Burkholderia glumae BGR1: bglu_1g32230Help
Entry
bglu_1g32230      CDS       T00905                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    bglu_1g32230
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bglu_1g32230
   00650 Butanoate metabolism
    bglu_1g32230
  Lipid metabolism
   00071 Fatty acid degradation
    bglu_1g32230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bglu_1g32230
   00310 Lysine degradation
    bglu_1g32230
   00360 Phenylalanine metabolism
    bglu_1g32230
   00380 Tryptophan metabolism
    bglu_1g32230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bglu_1g32230
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    bglu_1g32230
   00281 Geraniol degradation
    bglu_1g32230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bglu_1g32230
   00627 Aminobenzoate degradation
    bglu_1g32230
   00930 Caprolactam degradation
    bglu_1g32230
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     bglu_1g32230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3659672..3660502)
Genome map
AA seq 276 aa AA seqDB search
MSQPDAYAGYQALRLRRLPHGILEIVMSGEGANRSGLATADARMHRELAEIWRDLDRDPE
VRVALIRGEGKGFSAGGDLALVEQMADDFAVRTRVWHEARDLVYNVINCGKPIVSAMHGP
AVGAGLVAGLLADVSIAANDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGAQAERIGLVSLAVDAAELLPKALELAERLAHGSQSAIRWTKYALNNWLRMAGPTFDA
SLALEFMGFSGPDVREGIDSLRARRAPDFDGAAGKP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacccgatgcctacgccggctaccaggcgctgcggctgcggcgcctgccgcac
ggcatcctcgagatcgtgatgagcggcgagggcgccaaccgcagcggcctcgccaccgcc
gacgcgcgcatgcaccgcgagctcgccgaaatctggcgcgacctcgaccgcgatcccgag
gtgcgcgtcgcgctgatccgcggcgagggcaagggcttctcggcgggcggcgatctcgct
ctcgtcgagcagatggccgacgatttcgcggtgcgcacgcgcgtctggcacgaggcgcgc
gacctcgtctacaacgtgatcaactgcggcaagccgatcgtctcggcgatgcacgggccg
gcggtgggcgcggggctggtggccgggctgctggccgacgtgtcgatcgccgcgaacgac
gcgcgcatcatcgacggccatacgcggctcggggtggcggccggcgaccacgccgcgatc
gtctggccgctgttgtgcggcatggcgaaggccaagtatcacctgctgctctgcgagccg
gtgagcggggcgcaggccgagcgcatcgggctcgtgtcgctggccgtcgacgcggccgag
ctgctgccgaaggcgctggagctggccgagcggctcgcgcacggttcgcagagcgcgatt
cgctggaccaagtacgcgctcaacaactggctgcgcatggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggcttctcgggtccggacgtgcgcgagggcatcgactcg
ctgcgcgcgcggcgcgcgcccgacttcgacggcgcggccggcaagccgtga

DBGET integrated database retrieval system