KEGG   Burkholderia glumae BGR1: bglu_1g32230Help
Entry
bglu_1g32230      CDS       T00905                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00071  Fatty acid degradation
bgl00280  Valine, leucine and isoleucine degradation
bgl00281  Geraniol degradation
bgl00310  Lysine degradation
bgl00360  Phenylalanine metabolism
bgl00362  Benzoate degradation
bgl00380  Tryptophan metabolism
bgl00410  beta-Alanine metabolism
bgl00627  Aminobenzoate degradation
bgl00640  Propanoate metabolism
bgl00650  Butanoate metabolism
bgl00903  Limonene and pinene degradation
bgl00930  Caprolactam degradation
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01212  Fatty acid metabolism
Module
bgl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bglu_1g32230
   00650 Butanoate metabolism
    bglu_1g32230
  Lipid metabolism
   00071 Fatty acid degradation
    bglu_1g32230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bglu_1g32230
   00310 Lysine degradation
    bglu_1g32230
   00360 Phenylalanine metabolism
    bglu_1g32230
   00380 Tryptophan metabolism
    bglu_1g32230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bglu_1g32230
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    bglu_1g32230
   00281 Geraniol degradation
    bglu_1g32230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bglu_1g32230
   00627 Aminobenzoate degradation
    bglu_1g32230
   00930 Caprolactam degradation
    bglu_1g32230
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     bglu_1g32230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: ACR30286
UniProt: C5ADU6
Position
1:complement(3659672..3660502)
Genome map
AA seq 276 aa AA seqDB search
MSQPDAYAGYQALRLRRLPHGILEIVMSGEGANRSGLATADARMHRELAEIWRDLDRDPE
VRVALIRGEGKGFSAGGDLALVEQMADDFAVRTRVWHEARDLVYNVINCGKPIVSAMHGP
AVGAGLVAGLLADVSIAANDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGAQAERIGLVSLAVDAAELLPKALELAERLAHGSQSAIRWTKYALNNWLRMAGPTFDA
SLALEFMGFSGPDVREGIDSLRARRAPDFDGAAGKP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacccgatgcctacgccggctaccaggcgctgcggctgcggcgcctgccgcac
ggcatcctcgagatcgtgatgagcggcgagggcgccaaccgcagcggcctcgccaccgcc
gacgcgcgcatgcaccgcgagctcgccgaaatctggcgcgacctcgaccgcgatcccgag
gtgcgcgtcgcgctgatccgcggcgagggcaagggcttctcggcgggcggcgatctcgct
ctcgtcgagcagatggccgacgatttcgcggtgcgcacgcgcgtctggcacgaggcgcgc
gacctcgtctacaacgtgatcaactgcggcaagccgatcgtctcggcgatgcacgggccg
gcggtgggcgcggggctggtggccgggctgctggccgacgtgtcgatcgccgcgaacgac
gcgcgcatcatcgacggccatacgcggctcggggtggcggccggcgaccacgccgcgatc
gtctggccgctgttgtgcggcatggcgaaggccaagtatcacctgctgctctgcgagccg
gtgagcggggcgcaggccgagcgcatcgggctcgtgtcgctggccgtcgacgcggccgag
ctgctgccgaaggcgctggagctggccgagcggctcgcgcacggttcgcagagcgcgatt
cgctggaccaagtacgcgctcaacaactggctgcgcatggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggcttctcgggtccggacgtgcgcgagggcatcgactcg
ctgcgcgcgcggcgcgcgcccgacttcgacggcgcggccggcaagccgtga

DBGET integrated database retrieval system