KEGG   Burkholderia glumae BGR1: bglu_2g00220Help
Entry
bglu_2g00220      CDS       T00905                                 

Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00072  Synthesis and degradation of ketone bodies
bgl00650  Butanoate metabolism
bgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    bglu_2g00220
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    bglu_2g00220
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     bglu_2g00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C 3HCDH_N Epimerase IF2_N
Motif
Other DBs
NCBI-ProteinID: ACR30519
UniProt: C5AKR3
Position
2:complement(22968..23753)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALQLARAGAAVVIADLNQDGANAVAGQITQAGGKALGV
AMDVTNEDAVNAGIDKAAQTFGTIDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEDVIKKVMLGNTVDGVFTTVEDVAQTVLFLS
AFPSAAFTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatggcaagaccgcggtcgtgacgggcgccgcgagcggcatcggcaag
gaaatcgcactgcaactggccagggcgggcgcggccgtggtgatcgccgacctgaaccag
gacggcgcgaacgcggtggccgggcagatcacgcaggcgggcggcaaggcgctcggcgtg
gcgatggacgtcaccaacgaggacgcggtgaacgcgggcatcgacaaggccgcgcagacc
ttcggcacgatcgacatcctggtgtcgaacgccggcatccagatcgtcaatccgatcgag
aactactcgttcgccgattggaagaagatgcaggcgatccacgtggacggcgcgttcctg
accaccaaggccgcgctcaagcacatgtacaaggacgaccgcggcggcgtggtgatctac
atgggctcggtgcattcgcacgaggcatcgccgctgaagtcggcctacgtgacggccaag
cacggcctgctcgggctcgcgcgcgtgctggccaaggaaggcgcgaagcacaacgtgcgc
tcgcacgtggtctgcccgggcttcgtgcgcacgccgctcgtcgacaagcagatccccgag
caggccaaggagctcggcatcagcgaggaggacgtcatcaagaaggtgatgctcggcaat
accgtggacggcgtgttcacgacggtggaggacgtggcgcagacggtgctgttcctgtcg
gcgttcccgagcgcggcgttcacgggccagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system