KEGG   Burkholderia glumae: bglu_2g02760Help
Entry
bglu_2g02760      CDS       T00905                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bgl  Burkholderia glumae
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    bglu_2g02760
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_2g02760
   00650 Butanoate metabolism
    bglu_2g02760
  Amino acid metabolism
   00360 Phenylalanine metabolism
    bglu_2g02760
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bglu_2g02760
   00622 Xylene degradation
    bglu_2g02760
   00621 Dioxin degradation
    bglu_2g02760
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     bglu_2g02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:323239..324168
Genome map
AA seq 309 aa AA seqDB search
MKNRTTRAERQPRAAGTARTRVAILGSGSIGIDLMFKVKACEQFDLACVVGRNADSDGLR
LARECQVETSSDGLAFLRANAGAYDLVFDATSAAAHTEHNRFFAEAGKFAIDLTPAKVGR
LCVPCINLPDTHAVQNVNLITCGGQASLPLAYALRQAVDEIDYLEVVSAIASRSAGMATR
ENINEYQTTTEYALAKFSGAKRAKAILNINPAEPGIQMQTTLYAHARYRDFGRVRSRIQA
MVEQVREYVPGYQLVVEPLESQGRITVSLTVRGRGDYLPEYAGNLDIINCAALAVATHRH
ATLRSGVTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgaaccacccgtgccgagcgccagccgcgcgccgccggcaccgcgcgcacc
cgcgtcgccatcctcggctcgggcagcatcggcatcgacctgatgttcaaggtgaaggcc
tgcgagcagttcgatctcgcatgcgtggtcggacgcaacgcggacagcgacggcctgcgg
ctcgcgcgcgaatgccaggtggagacctcgagcgacgggctcgccttcctccgggccaac
gccggtgcctacgacctcgtcttcgacgccacctcggcggccgcgcacaccgagcacaac
cgctttttcgccgaggccggcaagttcgcgatcgacctgacgccggccaaggtcggccgg
ctctgcgtgccctgcatcaacctgcccgatacgcacgcggtgcagaacgtgaacctgatc
acctgcggcggccaggccagcctgccgctcgcctatgcgctgcgccaggccgtcgacgag
atcgactatctggaggtggtctcggcgatcgcctcgcgcagcgccggcatggccacgcgc
gagaacatcaacgagtatcagaccaccaccgagtacgcgctggcgaagttcagcggcgcg
aagcgcgccaaggcgatcctcaacatcaatccggccgagcccggcatccagatgcagacc
acgctgtatgcgcacgcgcgctaccgcgacttcggccgggtgcgctcgcgcatccaggcg
atggtcgagcaggtgcgcgagtacgtgcccggctaccagctggtggtggagccgctggag
agccaggggcgcatcaccgtgagcctgaccgtgcgcgggcgcggcgactacctgcccgag
tacgcgggcaacctcgacatcatcaactgcgcggcgctcgcggtggccacgcaccggcat
gcaacccttcgctcaggagtgacgcaatga

DBGET integrated database retrieval system