KEGG   Burkholderia glumae: bglu_2g02760Help
Entry
bglu_2g02760      CDS       T00905                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bgl  Burkholderia glumae
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bgl00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bgl00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bgl00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bgl00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bgl00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:323239..324168
Genome map
AA seq 309 aa AA seqDB search
MKNRTTRAERQPRAAGTARTRVAILGSGSIGIDLMFKVKACEQFDLACVVGRNADSDGLR
LARECQVETSSDGLAFLRANAGAYDLVFDATSAAAHTEHNRFFAEAGKFAIDLTPAKVGR
LCVPCINLPDTHAVQNVNLITCGGQASLPLAYALRQAVDEIDYLEVVSAIASRSAGMATR
ENINEYQTTTEYALAKFSGAKRAKAILNINPAEPGIQMQTTLYAHARYRDFGRVRSRIQA
MVEQVREYVPGYQLVVEPLESQGRITVSLTVRGRGDYLPEYAGNLDIINCAALAVATHRH
ATLRSGVTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgaaccacccgtgccgagcgccagccgcgcgccgccggcaccgcgcgcacc
cgcgtcgccatcctcggctcgggcagcatcggcatcgacctgatgttcaaggtgaaggcc
tgcgagcagttcgatctcgcatgcgtggtcggacgcaacgcggacagcgacggcctgcgg
ctcgcgcgcgaatgccaggtggagacctcgagcgacgggctcgccttcctccgggccaac
gccggtgcctacgacctcgtcttcgacgccacctcggcggccgcgcacaccgagcacaac
cgctttttcgccgaggccggcaagttcgcgatcgacctgacgccggccaaggtcggccgg
ctctgcgtgccctgcatcaacctgcccgatacgcacgcggtgcagaacgtgaacctgatc
acctgcggcggccaggccagcctgccgctcgcctatgcgctgcgccaggccgtcgacgag
atcgactatctggaggtggtctcggcgatcgcctcgcgcagcgccggcatggccacgcgc
gagaacatcaacgagtatcagaccaccaccgagtacgcgctggcgaagttcagcggcgcg
aagcgcgccaaggcgatcctcaacatcaatccggccgagcccggcatccagatgcagacc
acgctgtatgcgcacgcgcgctaccgcgacttcggccgggtgcgctcgcgcatccaggcg
atggtcgagcaggtgcgcgagtacgtgcccggctaccagctggtggtggagccgctggag
agccaggggcgcatcaccgtgagcctgaccgtgcgcgggcgcggcgactacctgcccgag
tacgcgggcaacctcgacatcatcaactgcgcggcgctcgcggtggccacgcaccggcat
gcaacccttcgctcaggagtgacgcaatga

DBGET integrated database retrieval system