KEGG   Burkholderia glumae: bglu_2g06270Help
Entry
bglu_2g06270      CDS       T00905                                 

Definition
acyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bgl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bgl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bgl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bgl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:752132..753826
Genome map
AA seq 564 aa AA seqDB search
MTAQAFLEARDFLLRHRTDYDTAYREFRWPQLDAFNWALDYFDVMARDNASPALWIVDAV
TGEGEPVSFARISAQSSRIANHLRALGVGRGERILLMLPNRVELWETMLAAMKLGAVVLP
ATTQLSADDIRDRVMIGEARFAVVDAAEAEKFDQAGVDLTRLIVGGERAGWLRFEDGYAA
DAAFTPDAPTHAHDPLLLYFTSGTTSKPKLVEHTHFTYPVGSLSTLYWIGLQPGDIHWNI
SSPGWAKHAWSCLFAPWNAGACVFAFNYPRFDPQQALEALVRYGVTTLCAPPTVWRMLVQ
QPLASYPVKLREIIGAGEPLNPEIIERVRRAWGVTIRDGYGQTETTCLIGNSPGQPVVAG
SMGRPMPGYRIALLDPDGAPVTEGEIALPLDGERPGGLMTGYANHPDATAWAMRDGHYRT
SDIALRRDDGYYLYIGRADDVFKSSDYRLSPFELESVLIEHEAVAEAAVVPSPDPLRLAV
PKTFITLRAGFEPGEALARDIFRFSREKLAPYKRIRRLQFTELPKTISGKIRRVELRRRE
IERDADPAARMPHEYWEEDFPSQS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcaggcttttctcgaggcacgcgattttctgttgcggcaccgcaccgattac
gacacggcgtaccgcgaattccgctggccgcaactggacgcgttcaactgggcgctcgat
tacttcgacgtgatggcgcgcgacaacgcgagccccgcgctgtggatcgtcgacgcggtc
acgggcgagggcgagccggtatcgttcgcgcgcatctcggcgcagtcctcgcggatcgcg
aaccacctgcgcgcgctcggcgtgggccgtggcgagcgcatcctgctgatgctgccgaac
cgcgtcgagctgtgggaaaccatgctcgccgcgatgaagctcggcgcggtcgtgctgccg
gccaccacgcagctgtcggccgacgacatccgcgaccgcgtgatgatcggcgaggcccgc
ttcgccgtggtcgacgcggccgaggccgagaagttcgaccaggccggcgtcgatctgacc
cggctgatcgtgggcggcgagcgtgccggctggctgcgcttcgaggatggctacgcggcc
gatgccgcgttcacgcccgacgcgcccacccacgctcacgacccgctgctgctctacttc
acgtcgggcaccacctcgaagccgaagctcgtcgagcatacccacttcacctacccggtg
ggcagcctctcgaccctgtactggatcgggctgcagcccggcgacatccattggaacatc
agctcgcccggttgggccaagcacgcctggagctgcttgttcgcgccctggaacgccggg
gcctgcgtgttcgcgttcaactacccgcgcttcgatccgcagcaggcgctcgaggcgctg
gtgcgctacggcgtgaccacgctgtgcgcgccgcccacggtctggcgcatgctggtgcag
cagccgctcgcgtcctacccggtgaagctgcgcgagatcatcggcgccggcgagccgctg
aaccccgagatcatcgagcgcgtgcggcgcgcctggggcgtgacgatccgcgacggctac
ggccagaccgaaaccacctgcctgatcggcaactcgccgggccagccggtggtggcgggc
tcgatggggcggccgatgccgggctaccggatcgcgctgctcgatcccgacggcgcgccg
gtgacggagggcgagatcgcgctgccgctcgacggcgagcgccccggcgggctgatgaca
ggctacgcgaatcaccccgacgccaccgcctgggcgatgcgcgacggccattaccgcacc
tcggacatcgcgctgcgccgcgacgacggttactacctctacatcggccgcgccgacgac
gtcttcaagtcgtccgactatcgcctgagcccgttcgagctcgagagcgtgctgatcgag
cacgaggccgtcgccgaggcggccgtggtgccgagccccgacccgctgcggctcgcggtg
cccaagaccttcatcacgctgcgcgccggcttcgagccgggcgaggcgctcgcgcgcgac
atcttccgcttctcgcgcgagaagctcgcgccgtacaagcgcatccgccgcctgcagttc
acggagctgccgaagaccatctcggggaagatccgccgcgtcgagctgcggcgccgcgag
atcgagcgcgatgccgatccggccgcgcgcatgccccacgagtactgggaagaggatttc
ccgagccagtcgtaa

DBGET integrated database retrieval system