KEGG   Burkholderia glumae BGR1: bglu_2g06270Help
Entry
bglu_2g06270      CDS       T00905                                 

Definition
(GenBank) Acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00620  Pyruvate metabolism
bgl00640  Propanoate metabolism
bgl00680  Methane metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_2g06270
   00620 Pyruvate metabolism
    bglu_2g06270
   00640 Propanoate metabolism
    bglu_2g06270
  Energy metabolism
   00680 Methane metabolism
    bglu_2g06270
Enzymes [BR:bgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     bglu_2g06270
Lipid biosynthesis proteins [BR:bgl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   bglu_2g06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACR31063
UniProt: C5AML2
Position
2:752132..753826
Genome map
AA seq 564 aa AA seqDB search
MTAQAFLEARDFLLRHRTDYDTAYREFRWPQLDAFNWALDYFDVMARDNASPALWIVDAV
TGEGEPVSFARISAQSSRIANHLRALGVGRGERILLMLPNRVELWETMLAAMKLGAVVLP
ATTQLSADDIRDRVMIGEARFAVVDAAEAEKFDQAGVDLTRLIVGGERAGWLRFEDGYAA
DAAFTPDAPTHAHDPLLLYFTSGTTSKPKLVEHTHFTYPVGSLSTLYWIGLQPGDIHWNI
SSPGWAKHAWSCLFAPWNAGACVFAFNYPRFDPQQALEALVRYGVTTLCAPPTVWRMLVQ
QPLASYPVKLREIIGAGEPLNPEIIERVRRAWGVTIRDGYGQTETTCLIGNSPGQPVVAG
SMGRPMPGYRIALLDPDGAPVTEGEIALPLDGERPGGLMTGYANHPDATAWAMRDGHYRT
SDIALRRDDGYYLYIGRADDVFKSSDYRLSPFELESVLIEHEAVAEAAVVPSPDPLRLAV
PKTFITLRAGFEPGEALARDIFRFSREKLAPYKRIRRLQFTELPKTISGKIRRVELRRRE
IERDADPAARMPHEYWEEDFPSQS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcaggcttttctcgaggcacgcgattttctgttgcggcaccgcaccgattac
gacacggcgtaccgcgaattccgctggccgcaactggacgcgttcaactgggcgctcgat
tacttcgacgtgatggcgcgcgacaacgcgagccccgcgctgtggatcgtcgacgcggtc
acgggcgagggcgagccggtatcgttcgcgcgcatctcggcgcagtcctcgcggatcgcg
aaccacctgcgcgcgctcggcgtgggccgtggcgagcgcatcctgctgatgctgccgaac
cgcgtcgagctgtgggaaaccatgctcgccgcgatgaagctcggcgcggtcgtgctgccg
gccaccacgcagctgtcggccgacgacatccgcgaccgcgtgatgatcggcgaggcccgc
ttcgccgtggtcgacgcggccgaggccgagaagttcgaccaggccggcgtcgatctgacc
cggctgatcgtgggcggcgagcgtgccggctggctgcgcttcgaggatggctacgcggcc
gatgccgcgttcacgcccgacgcgcccacccacgctcacgacccgctgctgctctacttc
acgtcgggcaccacctcgaagccgaagctcgtcgagcatacccacttcacctacccggtg
ggcagcctctcgaccctgtactggatcgggctgcagcccggcgacatccattggaacatc
agctcgcccggttgggccaagcacgcctggagctgcttgttcgcgccctggaacgccggg
gcctgcgtgttcgcgttcaactacccgcgcttcgatccgcagcaggcgctcgaggcgctg
gtgcgctacggcgtgaccacgctgtgcgcgccgcccacggtctggcgcatgctggtgcag
cagccgctcgcgtcctacccggtgaagctgcgcgagatcatcggcgccggcgagccgctg
aaccccgagatcatcgagcgcgtgcggcgcgcctggggcgtgacgatccgcgacggctac
ggccagaccgaaaccacctgcctgatcggcaactcgccgggccagccggtggtggcgggc
tcgatggggcggccgatgccgggctaccggatcgcgctgctcgatcccgacggcgcgccg
gtgacggagggcgagatcgcgctgccgctcgacggcgagcgccccggcgggctgatgaca
ggctacgcgaatcaccccgacgccaccgcctgggcgatgcgcgacggccattaccgcacc
tcggacatcgcgctgcgccgcgacgacggttactacctctacatcggccgcgccgacgac
gtcttcaagtcgtccgactatcgcctgagcccgttcgagctcgagagcgtgctgatcgag
cacgaggccgtcgccgaggcggccgtggtgccgagccccgacccgctgcggctcgcggtg
cccaagaccttcatcacgctgcgcgccggcttcgagccgggcgaggcgctcgcgcgcgac
atcttccgcttctcgcgcgagaagctcgcgccgtacaagcgcatccgccgcctgcagttc
acggagctgccgaagaccatctcggggaagatccgccgcgtcgagctgcggcgccgcgag
atcgagcgcgatgccgatccggccgcgcgcatgccccacgagtactgggaagaggatttc
ccgagccagtcgtaa

DBGET integrated database retrieval system