KEGG   Burkholderia glumae BGR1: bglu_2g07500Help
Entry
bglu_2g07500      CDS       T00905                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bglu_2g07500
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_2g07500
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_2g07500
Enzymes [BR:bgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     bglu_2g07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(905063..907231)
Genome map
AA seq 722 aa AA seqDB search
MNSMIQRHGLKIAESLARFVDTEALPGTGVDGDAFWSGFSAIVHDLAPKNRQLVAERERL
QHELNRWHRDHPGPVRDLRAYRQFLESIGYIVPAPSNVKASTANVDREIAEQAGPQLVVP
LSNPRYALNAANARWGSLYDALYGTDAIPDTNGAERGATYNPKRGARVVAFARRVLDEAV
PLAQGSHADATRYAVEGGKLVVTLANGSTQLKDPAQFIGHQGDAAAPSAVLLKHHGLHLE
IQIDANDAIGKTDPAHVKDLVLEAAVSTIIDCEDSVAAVDAADKVDLYRNWLGLMNGDLS
ESVTKGGKTFTRKLNADREYVGADGASVRLHGRSLLFIRNVGHLMTNPAVVDRDGNEIPE
GILDGVMTTLCALRDRQNRLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLALPRNT
IKMGIMDEERRTSVNLAACIAEAAPRVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKSS
RWIAAYERSNVLVGLAAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSPT
AATLHALHYHQVDVQAVQQALEATDPAAARDELLDGLLSVPVVEKANWSDAEIRAELENN
AQGILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVTRELVDET
LRRMAKVVDQQNAGDPHYQPMAPDFDKSLAFQAASALIYEGRAQPSGYTEPLLHRFRLQK
KG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatgatccagcgtcacgggctcaagatagccgagagcctcgcgcgcttcgtc
gataccgaggctctgcccggcaccggtgtcgacggcgacgcattctggtccggtttctcc
gcgatcgtccatgacctcgcgccgaagaaccgccagctcgtcgccgagcgcgagcgcctg
cagcacgaactgaatcgctggcaccgcgaccatcccggcccggtgcgcgacctgcgcgcc
taccgccagttcctcgagagcatcggctacatcgtgccggcgccgtcgaacgtgaaggcc
agcaccgccaacgtggatcgcgagatcgccgagcaggccggcccgcagctggtggtgccg
ctgtcgaacccgcgctacgcgctgaacgccgccaacgcgcgctggggcagcctctacgac
gcgctgtacggcaccgatgcgatccccgacacgaacggcgccgagcgcggcgcgacgtac
aacccgaagcgcggcgcgcgcgtggtggcgttcgcgcggcgcgtgctcgacgaggccgtg
ccgctcgcgcaaggctcgcatgccgacgccacgcgctacgcggtcgagggcggcaagctg
gtggtcacgctcgcgaacggtagcacgcagctgaaggacccggcgcaattcatcggccat
cagggcgacgcggccgcgccgtcggcggtgctgctcaagcaccacggcctgcacctggaa
atccagatcgacgcgaacgacgcgatcggcaagaccgacccggcgcacgtgaaggacctg
gtgctcgaggcggcggtctccaccatcatcgactgcgaggactcggtggcggcggtggac
gcggccgacaaggtcgacctctaccgcaactggctcggcctgatgaacggcgacctctcg
gagtcggtcacgaagggcggcaagaccttcacgcgcaagctcaatgccgaccgcgaatat
gtcggcgccgacggcgcgagcgtcaggctgcatggccgctcgctgctgttcatccgcaac
gtcggccacctgatgacgaatccggcggtggtcgatcgcgacggcaacgagattcccgaa
ggcattctcgacggcgtgatgaccacgctctgcgcgctgcgcgaccgccagaaccggctg
aactcgcgcaccggctcgatctacatcgtcaagccgaagatgcacggcccggccgaggtg
gcgttcgcgagcgagctgttcgcgcgcgtcgaggatctgctggcgctgccgcgcaacacc
atcaagatgggcatcatggacgaggagcgccgcaccagcgtcaacctcgccgcctgcatc
gccgaggccgcgccgcgcgtggcgttcatcaacaccggctttctcgaccgcaccggcgac
gagatgcatagcgcgatggaagccggcccgatgatgcgcaagggcgacatgaagtcgagc
cgctggatcgccgcctacgagcgcagcaacgtgctggtgggcctggccgccgggctgcgc
ggccgcgcgcagatcggcaagggcatgtgggcgatgccggacctgatgcacgccatgctc
gaacagaagatcgcgcacccgaaggccggcgcgaacacggcctgggtgccctcgccgacc
gccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgcaggccgtgcagcaggcg
ctcgaggccaccgacccggccgccgcgcgcgacgagctgctcgacgggctgctgtcggtg
ccggtggtggagaaggcgaactggagcgacgccgagatccgcgccgagctggagaacaac
gcgcagggcatactcggctacgtggtgcgctgggtcgaccagggcgtgggctgctcgaag
gtgcccgacatccacgacgtcgggctgatggaggatcgcgccacgctgcgcatctcgagc
cagcatatcgcgaactggctgcatcacggcgtggtcacgcgcgagctcgtcgacgagacg
ctcaggcggatggcgaaggtggtggaccagcagaacgccggcgatccgcactatcagccg
atggcgcccgacttcgacaagtcgctcgcgttccaggccgccagcgcgttgatctacgaa
ggccgcgcccagccgagcggctacaccgagccgctgctgcaccgcttccgcctgcagaag
aagggctga

DBGET integrated database retrieval system